Align Short-chain dehydrogenase (characterized, see rationale)
to candidate Pf6N2E2_1747 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= uniprot:A0A2E7P8M8 (258 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1747 Length = 244 Score = 112 bits (281), Expect = 6e-30 Identities = 86/244 (35%), Positives = 128/244 (52%), Gaps = 13/244 (5%) Query: 11 IVTGGASGIGGAISLQLAAEGAIPVVFARSEPDPQFWARLTGLQPRAALFQLELQDEARC 70 IVTGG GIG A +LA+ G PVVF D +L P ++ +E C Sbjct: 3 IVTGGTQGIGAATVEKLASLGH-PVVFTGR--DQSAGTQLAASLPNCTFVAGDVSNEDEC 59 Query: 71 GEAVAETVRRF-GRLDGLVNNAGVNDSVG-LDAGRNEFVASLERNLIHYYVMAHYCVPHL 128 VA ++ G+L GLVNNAG++ ++ + E+ N + + +P L Sbjct: 60 RNVVATALQLGNGKLAGLVNNAGMSGRKAFIETTQQEWDTLFAVNTRSVFFYTKHALPGL 119 Query: 129 KATRGAILNVSSKTALTGQGNTSGYCASKGAQLSLTREWAAALRDDG-VRVNALIPAEVM 187 A RGA++NVSS TG+ + YCASK A L LT+ A AL G VR NA+ P ++ Sbjct: 120 IAGRGAVVNVSSIAGKTGEQGLATYCASKAALLGLTQ--ALALEYGGQVRFNAVCPGQIA 177 Query: 188 TPLYEKWIATFENPQEKLDAITSKIPLGKRFTTSEEMADMAVFLLSGRSSHTTGQWVFVD 247 T + +K + N + +L A+T++IP G R ++ E+A+ +LLS +S+ G + VD Sbjct: 178 TRMMDKIV----NDEARLSALTARIPEG-RLASAREVAEAICWLLSPGASYVNGTTLTVD 232 Query: 248 GGYT 251 GG T Sbjct: 233 GGET 236 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 244 Length adjustment: 24 Effective length of query: 234 Effective length of database: 220 Effective search space: 51480 Effective search space used: 51480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory