GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dauA in Pseudomonas fluorescens FW300-N2E2

Align C4-dicarboxylic acid transporter DauA; Dicarboxylic acid uptake system A (characterized)
to candidate Pf6N2E2_5239 Putative sulfate permease

Query= SwissProt::P0AFR2
         (559 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5239 Putative sulfate
           permease
          Length = 580

 Score =  536 bits (1380), Expect = e-156
 Identities = 290/550 (52%), Positives = 390/550 (70%), Gaps = 14/550 (2%)

Query: 11  PFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAGI 70
           P  A     W+  YT  R   DL+AG+TVGIIAIPLAMALAI  GV PQ+GLYT  VA  
Sbjct: 7   PLFAAWRQAWRAGYTLERLRGDLVAGLTVGIIAIPLAMALAIAVGVPPQHGLYTVLVAAP 66

Query: 71  VIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIEY 130
           +IALTGGSRF+VSGPTAAFVVIL P++QQ GL GLL+ T+L+G+ LI +GL R GRLI+Y
Sbjct: 67  LIALTGGSRFNVSGPTAAFVVILLPITQQHGLGGLLLCTMLAGLILITLGLMRAGRLIQY 126

Query: 131 IPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIGI 190
           IP  V LGFT+GIG+ I T+Q+KD LGL      +HY++++G L +ALP+  +GD  IG+
Sbjct: 127 IPYPVILGFTAGIGVVIATLQLKDLLGLTTVGQAKHYIEQLGELIVALPSARLGDGIIGV 186

Query: 191 VTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGG-HVATIGSQFHYVLADGSQGNG 249
             L +L  WPR   R+PGHL ALL G A++G+    GG  VAT+G +F Y + DG    G
Sbjct: 187 TCLAVLFAWPRWVPRVPGHLVALLVG-ALLGLALERGGWPVATLGERFSY-MVDGISHPG 244

Query: 250 IPQLLPQLVLPWDLPNSE---FTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGT 306
           IP  LP    PW+LP+ +    TL++D IR LL  AF++AMLGAIESLLCAVV DGMTG+
Sbjct: 245 IPPFLPSFEWPWNLPDGQGHPLTLSYDLIRQLLGPAFAIAMLGAIESLLCAVVADGMTGS 304

Query: 307 KHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLV 366
           KH  N+EL+GQGLGN++AP FGGITATAAIARSA NVR+GA+SP++A+IHS++V+LA+++
Sbjct: 305 KHDPNAELIGQGLGNLVAPLFGGITATAAIARSATNVRSGASSPLAAIIHSLVVLLAMVL 364

Query: 367 LAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVLFDMVIA 426
           LAPL S+LP++A+AALL++VAWNMSEA  V+  LR AP+ D++V+L C+SLTVLFDMV+A
Sbjct: 365 LAPLFSYLPMAALAALLVIVAWNMSEAGHVLHTLRIAPRSDVLVLLTCLSLTVLFDMVMA 424

Query: 427 ISVGIVLASLLFMRRIARMTRLAPV-------VVDVPDDVLVLRVIGPLFFAAAEGLFTD 479
           ++VG++LA+ LF++R++ +T  A +       ++D+P+ V    + GPLFF AAE     
Sbjct: 425 VAVGLLLAAGLFIKRMSELTDSAELPRHFHQALLDMPEHVRCYAIRGPLFFGAAEKALDV 484

Query: 480 LESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRL-PEGCELRVCNVEFQPLRTMARAG 538
           L     G R+V+++  AVP+LD   L AF+  +K    +G  L +     +    + RAG
Sbjct: 485 LRKFDPGVRVVVVEMSAVPMLDMTALAAFENILKDYRKQGIGLILVATAPRVRLKLRRAG 544

Query: 539 IQPIPGRLAF 548
           I     +LA+
Sbjct: 545 IHREQRQLAY 554


Lambda     K      H
   0.328    0.142    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 798
Number of extensions: 44
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 559
Length of database: 580
Length adjustment: 36
Effective length of query: 523
Effective length of database: 544
Effective search space:   284512
Effective search space used:   284512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory