Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate Pf6N2E2_992 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)
Query= uniprot:A0A161GM94 (322 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_992 Length = 342 Score = 140 bits (354), Expect = 3e-38 Identities = 95/294 (32%), Positives = 152/294 (51%), Gaps = 21/294 (7%) Query: 39 LMIDNFLSPLNMRGLGLAISTTGIAACTMLYCLASGH-FDLSVGSVIACAGVVAAVVMRD 97 L +DNFL+P N+ + ++S GIAA M + SG+ F LS+ + A + +V A Sbjct: 56 LSVDNFLTPANLNAIMYSVSAIGIAAVGMAFITLSGNLFMLSMAATAALSTIVFA----- 110 Query: 98 TNSVFLGISAAL----VMGLIVGLINGIVIAKLRVNALITTLATMQIVRGL-AYIFANGK 152 +++ G+ AL V+G+ +G I G+V+ RVN +I T+A IV G+ +Y+ Sbjct: 111 -STLHFGLPVALLSVSVLGIAIGSIQGVVVGTARVNPIIATIAVASIVMGVGSYVSGGMT 169 Query: 153 AVGVSQESFFVFGNGQMFGVPVPILITIVCFLFFGWLLNY----TTYGRNTMAIGGNQEA 208 VG S+ G F VP + I FL F NY T +GR IG N Sbjct: 170 VVGKGDASWLGIGK---FASLVPNQLVI--FLAFSLAANYWVERTRFGRELRLIGLNPVT 224 Query: 209 ALLAGVNVDRTKIIIFAVHGVIGALAGVILASRMTSGQPMIGQGFELTVISACVLGGVSL 268 A +G+ V RT +I F + G ALAG + AS+ G + G + I+A ++ G+S+ Sbjct: 225 AAYSGIRVPRTLVIAFVIAGFSAALAGGLFASQAGQGNLKLAAGLDFDAIAAVLVAGISI 284 Query: 269 SGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSILLLAVVIDRLKQR 322 GG G I + G + LA+I N + + + Q +++G++++LAV++ L R Sbjct: 285 RGGQGKIIDAVYGAIFLALIGNLLLVHGLSFEIQLMVKGAVVVLAVILAALIAR 338 Lambda K H 0.330 0.144 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 342 Length adjustment: 28 Effective length of query: 294 Effective length of database: 314 Effective search space: 92316 Effective search space used: 92316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory