Align GguB aka ATU2346 aka AGR_C_4262, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate Pf6N2E2_1457 Xylose ABC transporter, permease protein XylH
Query= TCDB::O05177 (398 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1457 Length = 378 Score = 265 bits (676), Expect = 2e-75 Identities = 148/372 (39%), Positives = 225/372 (60%), Gaps = 10/372 (2%) Query: 22 SNIREYGMLIALVAIMVFFQFYTGGILFRPVNLTNLILQNSFIVIMALGMLLVIVAGHID 81 S + ++IA+ I +FF + T G P NL+NL+ Q S I+A GM+LVI++G ID Sbjct: 9 SRYKMLALVIAVALIWLFFSWQTEGGFVTPRNLSNLLRQMSITGILACGMVLVIISGEID 68 Query: 82 LSVGSIVAFVGAIAAILTVQWGMNPFLAALICLVIGG-IIGAAQGYWIAYHRIPSFIVTL 140 LSVGS++ +G +AAIL V + + P LA L + + G +IG GY AY RIPSFIV L Sbjct: 69 LSVGSLLGLLGGLAAILDVVYHI-PLLANLSLVALCGLVIGLGNGYMTAYLRIPSFIVGL 127 Query: 141 AGMLVFRGLTLFVLGGKNIGPFPTDFQVISTGFLPDIGGIEGLNTTSMILTVLITVALFY 200 GML FRG+ L V GG I P + + G+LP +T L +L+ + Sbjct: 128 GGMLAFRGVLLGVTGGTTIAPVSPELVYVGQGYLP--------HTVGTGLGILLFALTLF 179 Query: 201 LAWRRRVVNVKHGIDVEPFGFFIVQNLLISGAILFLGYQLSTYRGLPNVLIVMLVLIALY 260 L W++R HG+ +++ ++I + Y L++Y G+P ++++L+L+ ++ Sbjct: 180 LTWKQRRNRALHGLAAHSLVRDVLRVVVIGAVLAGFVYTLNSYDGIPVPVLLLLILLGVF 239 Query: 261 SFVTRRTTIGRRVYAMGGNEKATKLSGINTERLSFLTFVNMGVLAGLAGMIIATRLNSAT 320 S+VT +T GRRVY++G N +AT+LSGIN + + F MGV+ LAG++ RL + + Sbjct: 240 SYVTSQTVFGRRVYSVGSNMEATRLSGINVQAVKLWIFGIMGVMCALAGVVNTARLAAGS 299 Query: 321 PKAGVGFELDVIAACFIGGASASGGVGKITGAVIGAFIMGVMNNGMSIVGLGIDFQQMVK 380 P AG ELD IAACFIGG S GG G + GA++GA ++ ++NGMS++ + +Q +VK Sbjct: 300 PSAGNMGELDAIAACFIGGTSMRGGSGTVYGALLGALVITSLDNGMSMLDVDSYWQMIVK 359 Query: 381 GLVLLAAVFFDV 392 G +L+ AV+ DV Sbjct: 360 GSILVLAVWVDV 371 Lambda K H 0.329 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 36 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 378 Length adjustment: 30 Effective length of query: 368 Effective length of database: 348 Effective search space: 128064 Effective search space used: 128064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory