Align Altronate dehydratase; EC 4.2.1.7; D-altronate hydro-lyase (uncharacterized)
to candidate Pf6N2E2_3296 D-galactarate dehydratase (EC 4.2.1.42)
Query= curated2:O34673 (497 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3296 Length = 517 Score = 255 bits (651), Expect = 3e-72 Identities = 171/492 (34%), Positives = 255/492 (51%), Gaps = 28/492 (5%) Query: 4 FIKIHKQDNVLLALRD--IQKGERLHAYGVSIEVKDDIKRGHKIALQSIKENDSIVKYGF 61 +I++H++DNV++ + D + G V++ D + + HK+ L+ I + +++YG Sbjct: 12 YIRLHERDNVVIVVNDQGVPAGTEFPDGLVTV---DFVPQSHKVTLEDIPQGGEVIRYGQ 68 Query: 62 PIGHASQDISIGEHIHVHN----TKTNLSDIQLYSYTPRFDENPYSNENRTFKGFRRENG 117 IG+A Q I G + T L + L + P D E TF+G+R +G Sbjct: 69 VIGYALQPIPRGSWVKEDQLRMPTAPPLDSLPLSTDVPVADA---PLEGYTFEGYRNADG 125 Query: 118 DAGVRNELWIVPTVGCVNGIAEKMLQRFVRETGDIAP-FDNVLVLKHQYGCSQL--GDDH 174 G RN L I TV CV G+ + ++R E P D+V+ L H YGC D Sbjct: 126 TVGTRNILGITTTVQCVTGVLDHAVKRIKDELLPKYPNVDDVVALTHSYGCGVAITATDA 185 Query: 175 ENTKQILLNAIRHPNAGG-VLVLGLGCENNELAR-MKEALQDVNLKRVKFLESQSVTDEM 232 + + N R+PN GG LV+ LGCE + + M E V+L Q D Sbjct: 186 YIPIRTVRNLARNPNLGGEALVISLGCEKLQAGQVMHENDSSVDLSEPWLYRLQ---DSS 242 Query: 233 EAGVALLKEIHEAAKGD-------KREDIPLSELKIGLKCGGSDGFSGITANPLLGRFSD 285 ++++I E A+ +RE +P SEL +G++CGGSD FSGITANP LG SD Sbjct: 243 HGFTEMIEQIMELAETRLKKLDQRRRETVPASELILGMQCGGSDAFSGITANPALGYASD 302 Query: 286 YLIAQGGSTVLTEVPEMFGAETILMQRAANEEVFHKIVDLINDFKQYFIKHDQPVYENPS 345 L+ G + + +EV E+ A +L RA +EV ++V ++ + +Y K + N + Sbjct: 303 LLLRAGATVMFSEVTEVRDAIYLLTSRAQTQEVAQELVREMDWYDRYLAKGEADRSANTT 362 Query: 346 PGNKAGGISTLEDKSLGCTQKAGISPVTDVLKYGEVLKTKGLTLLSAPGNDLIASSALAA 405 PGNK GG+S + +KSLG K+G S + VL GE K KGL + P +D + + A Sbjct: 363 PGNKKGGLSNIVEKSLGSIVKSGSSAINGVLGPGERFKQKGLIFCATPASDFVCGTLQLA 422 Query: 406 AGCQIVLFTTGRGTPFG-TFVPTVKVATNTELYEAKPHWIDFNAGLLAEDDVHEEYVLRE 464 AG + +FTTGRGTP+G P VKV+T TEL + P ID +AG +A E + E Sbjct: 423 AGMNLHVFTTGRGTPYGLAMAPVVKVSTRTELAQRWPDLIDIDAGRIATGRATIEELGWE 482 Query: 465 FIHYMIEVASGQ 476 HY ++VASG+ Sbjct: 483 LFHYYLDVASGK 494 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 612 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 517 Length adjustment: 34 Effective length of query: 463 Effective length of database: 483 Effective search space: 223629 Effective search space used: 223629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory