Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized)
to candidate Pf6N2E2_1648 Maltose/maltodextrin ABC transporter, permease protein MalG
Query= reanno::Smeli:SMc02871 (279 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1648 Length = 280 Score = 144 bits (364), Expect = 2e-39 Identities = 92/264 (34%), Positives = 143/264 (54%), Gaps = 15/264 (5%) Query: 23 LIALFPVFLTIVNSFKSRNAIFREPLAVPTPETFSLIGYETVLKQGDFIGYFQNSIIVTV 82 L A+FP + IV S K +A+F+ + P+ FS Y VL Q F+ NS++V + Sbjct: 24 LYAVFPFYYAIVTSLKPSSALFQVSYWIDNPD-FS--NYAAVLGQASFLRAIGNSLVVAL 80 Query: 83 VSIALVLLFGAMAAFALSEYRFRGNTLMGLYLALGI-MIPIRLGTVAILQGMV----ATG 137 +AL LL AA+AL +FRG ++ L + LG+ M P VA+L G+ A G Sbjct: 81 CVVALALLLSLTAAYALGRVKFRGRGVV-LMMVLGVSMFP----QVAVLSGLFEVIRALG 135 Query: 138 LVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKNAGRIDGLSEYAIFLRLVLPLIRP 197 L NT ALIL YT LP V++L+ FM + +L+ A +DG S + R++LPL+ P Sbjct: 136 LYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTRVLLPLLWP 195 Query: 198 AMATVAVFTMIPIWNDLWFPLILAPAEATKTVTLGSQIFIG--QFVTNWNAVLSALSLAI 255 A+ T + I WN+ F L ++ +TV + + G W +++A L Sbjct: 196 ALVTTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALISGGSPHELPWGLLMAASVLVT 255 Query: 256 FPVLVLYVIFSRQLIRGITAGAVK 279 P+++L +IF R+++ G+TAGA+K Sbjct: 256 VPLVILVLIFQRRIVSGLTAGALK 279 Lambda K H 0.330 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 280 Length adjustment: 26 Effective length of query: 253 Effective length of database: 254 Effective search space: 64262 Effective search space used: 64262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory