Align PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 (characterized)
to candidate Pf6N2E2_3339 Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)
Query= SwissProt::A0A0H3H456 (472 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3339 Length = 954 Score = 105 bits (263), Expect = 5e-27 Identities = 100/338 (29%), Positives = 148/338 (43%), Gaps = 34/338 (10%) Query: 155 DARSVSVVIQNHNGLHVRPASKLVAALAGFNADL---VLEKGGKCVTPDSLNQIALLQVR 211 D S + + N +GLH RPA L F ++ +++ V+ SL+++ L R Sbjct: 281 DWPSARIGLANAHGLHARPAKILAQLAKSFEGEIRVRIVDGQDSAVSAKSLSKLLSLGAR 340 Query: 212 RNDTLRLLARGPDADAALAAFQALAAENFGEPTEAAPARRPASADRVE-----GKVVLYP 266 R L +A A+ AL A A E GE E P P SA R V+L P Sbjct: 341 RGQVLEFIAEPSIANDALPALLAAIEEGLGEEVEPLP---PPSAPRETVMAEVATVMLAP 397 Query: 267 QPQDRISRETSA---AIGQQQLRLKRAIDRTLEDLSA-----------------LTTLAE 306 + I +A AIG +++ +AID L SA + L E Sbjct: 398 ESGSLIQAVAAAPGIAIGPAHIQVLQAIDYPLRGESAAIERERLQNALNQVRRDIQGLIE 457 Query: 307 ATFSADIAAIFSGHHTLLDDPDLYAAACDIIRDEQCSAAWAWQQVLSDLSQQYRHLDDAY 366 + I IF H +LDDP+L ++ + SA AW V+ +++ L DA Sbjct: 458 RAKAKAIREIFITHQEMLDDPELSDEVDTRLKLGE-SAQAAWMGVVEAAAKEQEALQDAL 516 Query: 367 LQARYIDIEDILHRTLRHLNERNEALPQFSAPSILVADDIFPSTVLQLNAEQVKGICLQA 426 L R D+ D+ R L L E + P ILV D++ PS V +L+ +V GI Sbjct: 517 LAERAADLRDVGRRVLAQLCGV-ETPNEPDQPYILVMDEVGPSDVARLDPTRVAGILTAR 575 Query: 427 GSELSHGAIIARQAGI-AMLCQQSDALTLQDGENVILD 463 G +H AI+AR GI A++ + L L G +++LD Sbjct: 576 GGATAHSAIVARALGIPALVGAGAAVLLLAPGTSLLLD 613 Lambda K H 0.318 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 848 Number of extensions: 46 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 954 Length adjustment: 38 Effective length of query: 434 Effective length of database: 916 Effective search space: 397544 Effective search space used: 397544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory