Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate Pf6N2E2_1960 Various polyols ABC transporter, ATP-binding component
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1960 Length = 365 Score = 198 bits (503), Expect = 2e-55 Identities = 119/342 (34%), Positives = 183/342 (53%), Gaps = 11/342 (3%) Query: 21 DLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFDGTDVTGMPVQKRNVAMVYQ 80 DL ++ V +GP+ GK++L+RL+AGL+ T G+I DG D+T + KR++AMV+Q Sbjct: 23 DLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGTIELDGRDITEVTPAKRDLAMVFQ 82 Query: 81 QFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKLTPYLDRTPLNLSGGQQQRT 140 + YP +TV N++ + ++G+ ++R+V +AA +L+L LDR P LSGGQ+QR Sbjct: 83 TYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAARILELGSLLDRKPKQLSGGQRQRV 142 Query: 141 ALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQSGAIFVYATTEPSEALLLGG 200 A+ RA+V+N + L DEPL+NLD LR + R EL ++ + A +Y T + EA+ L Sbjct: 143 AIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSRLHKELQATMIYVTHDQVEAMTLAT 202 Query: 201 NTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLDVT-----KSGNVFTRPSGV 255 LN GR+ Q G +E+Y P NL AG P + L T SG SG Sbjct: 203 KVVVLNAGRIEQIGSPLELYHHPANLFVAGFLGTPKMGFLQATVHAVHASGVEVRFASGT 262 Query: 256 TIPVPSHLAVVPDG-PVTIAFHPHHLGLAPQTGDAARLQARTLVSEITGSESFVHLEYD- 313 T+ +P + + G VTI P HL L+ + ++ T V+E GS++F H+ D Sbjct: 263 TLLIPRDSSALSVGQSVTIGIRPEHLTLSAE----GQVPVTTDVTERLGSDTFCHVNVDS 318 Query: 314 GVRWVMLAHGIHDIDPDMEVEAFLDTRHLMAFGSDGRAIAAA 355 G + G ++ LD H F G +++ A Sbjct: 319 GESLTVRVQGDCEVPYAARRYLTLDVAHCHLFDESGLSVSPA 360 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 365 Length adjustment: 29 Effective length of query: 329 Effective length of database: 336 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory