GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadA in Pseudomonas fluorescens FW300-N2E2

Align acetyl-CoA C-acetyltransferase (EC 2.3.1.16) (characterized)
to candidate Pf6N2E2_2113 Acetyl-CoA acetyltransferase (EC 2.3.1.9)

Query= metacyc::MONOMER-20831
         (393 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113 Acetyl-CoA
           acetyltransferase (EC 2.3.1.9)
          Length = 393

 Score =  715 bits (1846), Expect = 0.0
 Identities = 365/393 (92%), Positives = 379/393 (96%)

Query: 1   MQDVVIVAATRTAVGSFQGSLASIPAPELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAG 60
           MQ+VVIVAATRTA+GSFQGSLASIPAPELGAAVIR LLEQTGL   QVDEVILGQVLTAG
Sbjct: 1   MQEVVIVAATRTAIGSFQGSLASIPAPELGAAVIRHLLEQTGLSGEQVDEVILGQVLTAG 60

Query: 61  SGQNPARQASILAGLPHAVPSLTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL 120
           SGQNPARQASILAGLPHAVP+LTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL
Sbjct: 61  SGQNPARQASILAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL 120

Query: 121 APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA 180
           APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISRE QDAFAA
Sbjct: 121 APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREEQDAFAA 180

Query: 181 ASQQKATAAIEAGRFVDEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG 240
           ASQQKA AAIE GRF DEITPILIPQRKGDPVAFA DEQPRAGTTAESL KLKPAFKKDG
Sbjct: 181 ASQQKAVAAIEGGRFADEITPILIPQRKGDPVAFATDEQPRAGTTAESLGKLKPAFKKDG 240

Query: 241 SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRC 300
           SVTAGNASSLNDGAAAV+LMSA+KAKALGLPVLA+I++YANAGVDPAIMGIGPVSATRRC
Sbjct: 241 SVTAGNASSLNDGAAAVILMSAEKAKALGLPVLAKISAYANAGVDPAIMGIGPVSATRRC 300

Query: 301 LDKAGWSLGDLDLIEANEAFAAQSLAVGKELEWDAEKVNVNGGAIAIGHPIGASGCRVLV 360
           LDKAGWSL  LDLIEANEAFAAQSLAV +EL+WD +KVNVNGGAIA+GHPIGASGCRVLV
Sbjct: 301 LDKAGWSLDQLDLIEANEAFAAQSLAVARELKWDMDKVNVNGGAIALGHPIGASGCRVLV 360

Query: 361 TLLHEMIKRDAKKGLATLCIGGGQGVALALERS 393
           +LLHEMIKRDAKKGLATLCIGGGQGVALALER+
Sbjct: 361 SLLHEMIKRDAKKGLATLCIGGGQGVALALERA 393


Lambda     K      H
   0.317    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 604
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 393
Length of database: 393
Length adjustment: 31
Effective length of query: 362
Effective length of database: 362
Effective search space:   131044
Effective search space used:   131044
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate Pf6N2E2_2113 (Acetyl-CoA acetyltransferase (EC 2.3.1.9))
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01930.hmm
# target sequence database:        /tmp/gapView.25190.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01930  [M=385]
Accession:   TIGR01930
Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   3.5e-153  496.0   5.5   3.9e-153  495.9   5.5    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113  Acetyl-CoA acetyltransferase (EC


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113  Acetyl-CoA acetyltransferase (EC 2.3.1.9)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  495.9   5.5  3.9e-153  3.9e-153       1     385 []       6     391 ..       6     391 .. 0.99

  Alignments for each domain:
  == domain 1  score: 495.9 bits;  conditional E-value: 3.9e-153
                                      TIGR01930   1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaRea 64 
                                                    iv+a+Rt+ig+++gsl++++a +L+aavi++lle++gl+ e++devilG+vl+ag+++n+aR+a
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113   6 IVAATRTAIGSFQGSLASIPAPELGAAVIRHLLEQTGLSGEQVDEVILGQVLTAGSGQNPARQA 69 
                                                    8*************************************************************** PP

                                      TIGR01930  65 alaaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrres 128
                                                     + aglp+ vpalt+n+vC+Sgl+A++l+aq+i++G+a+v++aGG+E+mS +p++l+a+  r +
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113  70 SILAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSLAPYVLPAA--RTG 131
                                                    *********************************************************98..89* PP

                                      TIGR01930 129 lklgkakledqllkdl...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkf 189
                                                    l++g+ak+ d+++ d+   + ++++mg+tAenl +kygisReeqD++a++S+qka +Aie g+f
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113 132 LRMGHAKMIDSMITDGlwdAFNDYHMGITAENLVDKYGISREEQDAFAAASQQKAVAAIEGGRF 195
                                                    *******************99******************************************* PP

                                      TIGR01930 190 kdeivpvevkgk...kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaal 250
                                                    +dei+p+ ++++   ++ +++De++r++tt+e+L+kLkpafk+ +gs vtAgN+s+lnDGAaa+
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113 196 ADEITPILIPQRkgdPVAFATDEQPRAGTTAESLGKLKPAFKK-DGS-VTAGNASSLNDGAAAV 257
                                                    *********9999999*************************95.9*7.**************** PP

                                      TIGR01930 251 llmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFA 314
                                                    +lms e+ak+lgl +la+i ++a+agvdp++mg+gpv A++++L+kag+s++++dl+E nEAFA
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113 258 ILMSAEKAKALGLPVLAKISAYANAGVDPAIMGIGPVSATRRCLDKAGWSLDQLDLIEANEAFA 321
                                                    **************************************************************** PP

                                      TIGR01930 315 aqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGq 378
                                                    aq lav++el+  d +kvNvnGGAiAlGHP+GasG+r++++ll+e+ +r++k GlatlC+ggGq
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113 322 AQSLAVARELK-WDMDKVNVNGGAIALGHPIGASGCRVLVSLLHEMIKRDAKKGLATLCIGGGQ 384
                                                    ***********.88************************************************** PP

                                      TIGR01930 379 GaAvile 385
                                                    G+A+ le
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2113 385 GVALALE 391
                                                    ***9886 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (385 nodes)
Target sequences:                          1  (393 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.17
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory