Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate Pf6N2E2_2512 UDP-glucose 4-epimerase (EC 5.1.3.2)
Query= BRENDA::Q9WYX9 (309 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2512 Length = 340 Score = 169 bits (429), Expect = 6e-47 Identities = 111/324 (34%), Positives = 171/324 (52%), Gaps = 21/324 (6%) Query: 4 LVTGGAGFIGSHVVDKLIENGYGVIVVDNLSSGKVENLNRN---------ALFYEQSIED 54 L+TG AGFIGS++++ L++ VI +DN ++G NL+ A F + + Sbjct: 19 LITGVAGFIGSNLLETLLKLDQSVIGLDNFATGHQRNLDEVKGEVSADQWARFTLKVGDI 78 Query: 55 EEMMERIFSLHRPEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKKFIF 114 + + + +YV H AA SV S+ +P +NI G L +L + GVK F + Sbjct: 79 RTLDDCRNACEGVDYVLHEAALGSVPRSLADPILTNASNIDGFLNMLVAARDAGVKSFTY 138 Query: 115 SSTGGAIYGENVKVFPTPETEIPHPISPYGIAKYSTEMYLEFFAREYGLKYTVLRYANVY 174 +++ YG++ P E I P+SPY + KY E+Y + F + YG LRY NV+ Sbjct: 139 AASSST-YGDH-PALPKVEDVIGKPLSPYAVTKYVNELYADVFYKSYGFNTIGLRYFNVF 196 Query: 175 GPRQDPYGE-AGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLAMEKGD--- 230 G RQDP G A V+ + M+ E ++I GDG RD+ ++++VV+ANLLA + Sbjct: 197 GKRQDPNGAYAAVIPKWAAAMILDENININGDGSTSRDFCFIENVVQANLLAATEEKNYA 256 Query: 231 -NEVFNIGTGRGTTVNQLFKLLKEI-----TGYDKEPVYKPPRKGDVRKSILDYTKAKEK 284 N V+N+ T++ +LF +LK + Y KEPVYK R GDV S K K Sbjct: 257 LNNVYNVAVNARTSLEELFSMLKAMLADLGVNYAKEPVYKDFRAGDVLHSQASIEKIKNN 316 Query: 285 LGWEPKVSLEEGLKLTVEYFRKTL 308 L + P S+ EGL+L + ++ K + Sbjct: 317 LSYVPDYSVAEGLRLAMPWYLKNV 340 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 340 Length adjustment: 28 Effective length of query: 281 Effective length of database: 312 Effective search space: 87672 Effective search space used: 87672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory