Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate Pf6N2E2_2611 UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)
Query= curated2:A8GWP0 (341 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2611 Length = 333 Score = 213 bits (543), Expect = 4e-60 Identities = 132/335 (39%), Positives = 191/335 (57%), Gaps = 16/335 (4%) Query: 1 MFVDKTLLITGGTGSFGNAVLSRFLKNDIIKDIKEIRIFSRDEKKQEDMRIALNNPKIKF 60 MF K++ I+GGTGSFG + R L+ K + +FSRDE KQ +M+ N P +++ Sbjct: 1 MFNGKSIFISGGTGSFGRNFIRRLLEQ---YQPKRVVVFSRDELKQYEMQQTFNAPCMRY 57 Query: 61 YIGDVRNYNSIDDAMKDVDYVFHAAALKQVPTCEFYPMEAINTNILGAENVLRAATINKV 120 ++GDVR+ + + AM+ +DYV HAAALKQVP E+ P E I TN+ GAEN++ AA N V Sbjct: 58 FLGDVRDADRLRQAMRGIDYVVHAAALKQVPAAEYNPTECIRTNVNGAENIIAAAIDNGV 117 Query: 121 AKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMNVRDKTVFCVTRYGNVMASRGSVIP 180 KV+ LSTDKA PIN G +K L +KL +A + +T F V RYGNV SRGSV+P Sbjct: 118 KKVVALSTDKAASPINLYGATKLLSDKLFVAANNIAGEQQTRFAVVRYGNVAGSRGSVVP 177 Query: 181 LFINQIKQN-KDLTITEPSMTRFLMSLVDSVDLVLYAFEYGHQGDIFVQKSPASTIEVLA 239 F I L IT+ MTRF ++L V VL +F H G++FV K P+ I LA Sbjct: 178 FFSKLIADGATQLPITDERMTRFWITLDHGVQFVLDSFARMHGGEVFVPKIPSIRIVDLA 237 Query: 240 KALQGIFNSKNKIRFIGTRHGEKHYESLVSSEEMAKAEDLGNYYRIPMDGR----DLNYA 295 + G KN +G R GEK +E +V ++ + ++Y I R D+++ Sbjct: 238 SGMAGHLPHKN----VGIRPGEKLHELMVPLDDARMTIEFADHYTIQPSIRFTSVDVDFG 293 Query: 296 KYFVEGEKKIALLEDY---TSHNTKRLNLEEVKEL 327 + GE+ + ED+ + N L++E++ +L Sbjct: 294 VDNL-GERGKPVAEDFEYRSDTNPHFLSVEQIADL 327 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 333 Length adjustment: 28 Effective length of query: 313 Effective length of database: 305 Effective search space: 95465 Effective search space used: 95465 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory