Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate Pf6N2E2_1004 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1004 Length = 252 Score = 138 bits (347), Expect = 1e-37 Identities = 86/256 (33%), Positives = 129/256 (50%), Gaps = 27/256 (10%) Query: 17 ERLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALK 76 +RL NKV L+TG GIG AI FA + A +++ D+ + + V A Sbjct: 13 KRLHNKVALVTGGGMGIGRAIAELFAEEGATVIVGDVHQPEPY--------KNDSVVAKH 64 Query: 77 ADVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPL-EMTEEDWRRCFAIDLDGAWY 135 DVS +D + V HG++DVLVN AG+ P+ E+T +DW R I+ +G +Y Sbjct: 65 LDVSKLEDWELLVAEVVREHGKVDVLVNNAGLVGSYLPIDEITLDDWNRVIDINQNGVFY 124 Query: 136 GCKAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRV 195 G + V+P M Q GSI+N++S G Y +K + +++ + Y G+RV Sbjct: 125 GMRTVVPVMKRQHAGSIVNVSSIWGIVGASGVSAYQASKAAVRMMSKNAALSYVANGIRV 184 Query: 196 NAIAPGYIETQLNVDYWNGFADPYAERQRA------LDLHPPRRIGQPIEVAMTAVFLAS 249 N++ PG +ET P +RQ A + P +R P E+A A+FLAS Sbjct: 185 NSLHPGLVET------------PMIDRQAADITAAVVAATPMKRAADPKEIAYAALFLAS 232 Query: 250 DEAPFINASCITIDGG 265 DEA FI + + +DGG Sbjct: 233 DEASFITGAELVVDGG 248 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 252 Length adjustment: 25 Effective length of query: 247 Effective length of database: 227 Effective search space: 56069 Effective search space used: 56069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory