Align KguT (characterized, see rationale)
to candidate Pf6N2E2_610 Nitrate/nitrite transporter
Query= uniprot:A0A167V864 (425 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_610 Length = 440 Score = 196 bits (497), Expect = 2e-54 Identities = 124/419 (29%), Positives = 203/419 (48%), Gaps = 22/419 (5%) Query: 5 RLAPRRWWYIMPIVFITYSLAYLDRANYGFAAASGMADDLHITPALSSLLGALFFLGYFF 64 RL R ++P + + Y +AY+DR+ GFA M D+ I A L LFF+GYF Sbjct: 6 RLIRRITLKLIPFLILLYLIAYVDRSAVGFAKLH-MGADIGIGDAAYGLGAGLFFIGYFL 64 Query: 65 FQVPGAIYAEKRSVKKLIFVSLILWGGLATLTGMVQSVSLLIAIRFLLGVVEAAVMPAML 124 ++P + E+ ++ +I WG + VQ +RFLLG EA P +L Sbjct: 65 LEIPSNLMLERYGARRWFARIMITWGAITIGMAFVQGPHSFYVMRFLLGAAEAGFFPGVL 124 Query: 125 IYLCHWFTRAERSRANTFLILGNPVTILWMSVVSGYLVKH------FDWRWMFIIEGLPA 178 Y+ WF R + IL P+ ++ VSG L+ W+W+FI+ GLPA Sbjct: 125 YYITQWFPVRHRGKILGLFILSQPIAMMITGPVSGGLLGMDGILGLHGWQWLFIVIGLPA 184 Query: 179 VLWAFIWWRLVDDRPEQASWLKAQEKTALREALAAEQQGIKPVK--NYREAFRSPKVIIL 236 VL + R + D P+Q W+ EK L L + Q + N A + +V++L Sbjct: 185 VLLTWPVLRYLPDGPQQVKWMDQAEKDWLTGELKKDLQEYGQTRHGNPLHALKDKRVLLL 244 Query: 237 SLQYFCWSIGVYGFVLWLPSILKQAAALDIVTAGWLSAVPYLGAVLAMLGVSWASDRMQK 296 +L Y ++ +YG LWLP+++KQ D+VT G++S+VPY+ ++ +L + +SDR+ Sbjct: 245 ALFYLPVTLSIYGLGLWLPTLIKQFGGSDLVT-GFVSSVPYIFGIIGLLIIPRSSDRLND 303 Query: 297 RKRFVWPPLLIAALAFYGSYILGTEHFWWSYTLLVIAGAC-----MYAPYGPFFAIVPEL 351 R + ++ A+ + S W S +L +A C +++ F+ + Sbjct: 304 RYGHLAVLYVLGAIGLFLS-------AWLSVPVLQLAALCLVAFALFSCTAVFWTLPGRF 356 Query: 352 LPSNVAGGAMALINSMGALGSFSGSWLVGYLNGVTGGPGASYLFMCGALLVAVALTAVL 410 A +ALINS+G LG + G +++G L TG + F+ +L + LT V+ Sbjct: 357 FAGASAAAGIALINSVGNLGGYIGPFVIGALKEYTGNLASGLYFLSCVMLFGLVLTGVV 415 Lambda K H 0.328 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 638 Number of extensions: 42 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 440 Length adjustment: 32 Effective length of query: 393 Effective length of database: 408 Effective search space: 160344 Effective search space used: 160344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory