Align branched-chain-2-oxoacid decarboxylase (subunit 2/2) (EC 4.1.1.72) (characterized)
to candidate Pf6N2E2_666 Acetoin dehydrogenase E1 component beta-subunit (EC 1.2.4.-)
Query= BRENDA::Q9HIA4 (319 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_666 Length = 338 Score = 275 bits (704), Expect = 9e-79 Identities = 155/329 (47%), Positives = 206/329 (62%), Gaps = 17/329 (5%) Query: 5 QALNSAMDLKMSEDDSVIILGEDVGRD----------GGVFRVTDGLQAKYGPQRVIDTP 54 QA+N A+ +M D SV I+GEDV GGV VT GL ++ P RV+DTP Sbjct: 9 QAINEALAQEMRRDSSVFIMGEDVAGGAGAPGENDAWGGVLGVTKGLYDQF-PGRVLDTP 67 Query: 55 LSELGIVGMAIGMAVNGLKPIPEIQFQDFIYTSMDQIINQMAKIRYRSGGDYTVPLVLRT 114 LSE+G VG A+G A G++P+ E+ F DF +DQI+NQ AK RY GG + PLV+RT Sbjct: 68 LSEIGYVGAAVGAATCGVRPVCELMFVDFAGCCLDQILNQAAKFRYMFGGKASTPLVIRT 127 Query: 115 PVGGGIKGGLYHSQSGEAYFAHTAGLTVVSPSNPYDAKGLLISAIESPDPVIFLEPKRLY 174 VG G++ HSQ + + H GL VV PS+PYDAKGLLI AI DPVIF E K LY Sbjct: 128 MVGAGLRAAAQHSQMLTSLWTHIPGLKVVCPSSPYDAKGLLIQAIRDNDPVIFCEHKLLY 187 Query: 175 RAQKVEVPDEKYTIPLRKANVLKQGNDVTIVTYGSMVPTVMSVA---SKSKYDVEVIDLR 231 Q EVP+E YTIP +AN L+ G DVT+V+YG V T M A + D EVIDLR Sbjct: 188 SMQG-EVPEELYTIPFGEANFLRDGKDVTLVSYGRTVNTAMDAARSLAGRGIDCEVIDLR 246 Query: 232 TIAPMDRDTIISSVKKTGRVVIVHEAPRTLGVGAEISAMISERAIEYLYAPIVRVTGPDT 291 T +P+D D+I+ SV+KTGR+V++ EA + +ISA+++++A L API VT P T Sbjct: 247 TTSPLDEDSILESVEKTGRLVVIDEANPRCSMATDISALVAQKAFGALKAPIEMVTAPHT 306 Query: 292 PFPY--RLEEYYLPNEGRINAALDRVMSF 318 P P+ LE+ Y+P+ +I A+ V+ + Sbjct: 307 PVPFSDSLEDLYIPDAAKIEQAVLNVIEW 335 Lambda K H 0.318 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 338 Length adjustment: 28 Effective length of query: 291 Effective length of database: 310 Effective search space: 90210 Effective search space used: 90210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory