GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ilvE in Pseudomonas fluorescens FW300-N2E2

Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate Pf6N2E2_477 Branched-chain amino acid aminotransferase (EC 2.6.1.42)

Query= reanno::pseudo5_N2C3_1:AO356_22970
         (339 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477 Branched-chain amino
           acid aminotransferase (EC 2.6.1.42)
          Length = 339

 Score =  684 bits (1765), Expect = 0.0
 Identities = 333/339 (98%), Positives = 336/339 (99%)

Query: 1   MGNESINWDKLGFDYIKTDKRYLSHWRDGAWDAGTLTDDNVLHISEGSTALHYGQQCFEG 60
           MGNESINWDKLGFDYIKTDKRYLSHWRDGAWDAGTLT+DNVLHISEGSTALHYGQQCFEG
Sbjct: 1   MGNESINWDKLGFDYIKTDKRYLSHWRDGAWDAGTLTEDNVLHISEGSTALHYGQQCFEG 60

Query: 61  LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPQVETEQFVEACKQVVRANERFIPPYGT 120
           LKAYRCKDGSINLFRPDQNAARMQRSCARLLMP V+TEQFVEACKQVVRANERFIPPYGT
Sbjct: 61  LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVDTEQFVEACKQVVRANERFIPPYGT 120

Query: 121 GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSFDRAAPQGT 180
           GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSFDRAAPQGT
Sbjct: 121 GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSFDRAAPQGT 180

Query: 181 GAAKVGGNYAASLMPGSQAKKASFADCIYLDPMTHSKIEEVGSANFFGITHDNTFVTPRS 240
           GAAKVGGNYAASLMPGSQAKKA+FADCIYLDPMTHSKIEEVGSANFFGITHDN FVTP S
Sbjct: 181 GAAKVGGNYAASLMPGSQAKKANFADCIYLDPMTHSKIEEVGSANFFGITHDNKFVTPNS 240

Query: 241 PSVLPGITRLSLIELAKSRLGLEVIEGDVFIDKLSDFKEAGACGTAAVITPIGGISYKDK 300
           PSVLPGITRLSLIELAKSRLGLEVIEGDVFIDKLSDFKEAGACGTAAVITPIGGISYKDK
Sbjct: 241 PSVLPGITRLSLIELAKSRLGLEVIEGDVFIDKLSDFKEAGACGTAAVITPIGGISYKDK 300

Query: 301 LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339
           LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV
Sbjct: 301 LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339


Lambda     K      H
   0.320    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 592
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 339
Length of database: 339
Length adjustment: 28
Effective length of query: 311
Effective length of database: 311
Effective search space:    96721
Effective search space used:    96721
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Pf6N2E2_477 (Branched-chain amino acid aminotransferase (EC 2.6.1.42))
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01123.hmm
# target sequence database:        /tmp/gapView.18381.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01123  [M=313]
Accession:   TIGR01123
Description: ilvE_II: branched-chain amino acid aminotransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   2.5e-142  459.4   0.0   2.9e-142  459.2   0.0    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477  Branched-chain amino acid aminot


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477  Branched-chain amino acid aminotransferase (EC 2.6.1.42)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  459.2   0.0  2.9e-142  2.9e-142       1     313 []      31     339 .]      31     339 .] 0.99

  Alignments for each domain:
  == domain 1  score: 459.2 bits;  conditional E-value: 2.9e-142
                                     TIGR01123   1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPel 65 
                                                   Wd+++l++++ l+++egs++lhYgq++feGlkayR++dG+i+lfRpd+na+R++rs+ rll+P++
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477  31 WDAGTLTEDNVLHISEGSTALHYGQQCFEGLKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHV 95 
                                                   ***************************************************************** PP

                                     TIGR01123  66 eeelflealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkg 130
                                                   ++e+f+ea+kq+v+a+++++p+++++ +LYlRPf+i+++dn+Gv++a+e++f++++ PvGaYfkg
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477  96 DTEQFVEACKQVVRANERFIPPYGTGGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKG 160
                                                   ***************************************************************** PP

                                     TIGR01123 131 glapvsifveteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaa 195
                                                   gl+p ++f+ + ++Raap+GtGa+kvgGnYaasl++ ++a++ +++d++yldp+++ kieevG+a
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477 161 GLTP-HNFLISSFDRAAPQGTGAAKVGGNYAASLMPGSQAKKANFADCIYLDPMTHSKIEEVGSA 224
                                                   ****.99********************************************************** PP

                                     TIGR01123 196 niflitkdgelvttplsesiLegvtresllelakd.lgleveereiaidelkaaveaGeivfacG 259
                                                   n+f+it+d ++++tp+s+s+L+g+tr sl+elak+ lglev e+++ id+l++++eaG    acG
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477 225 NFFGITHD-NKFVTPNSPSVLPGITRLSLIELAKSrLGLEVIEGDVFIDKLSDFKEAG----ACG 284
                                                   ********.**************************9**********************....*** PP

                                     TIGR01123 260 taavitPvgelkiegkevevkse.evGevtkklrdeltdiqyGkledkegWivev 313
                                                   taavitP+g+++ ++k ++++se evG++t+kl++elt++q+G++e++ gWiv+v
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_477 285 TAAVITPIGGISYKDKLHVFHSEtEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339
                                                   *********************999*****************************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (313 nodes)
Target sequences:                          1  (339 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.85
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory