Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate Pf6N2E2_50 Biosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57) @ Aromatic-amino-acid aminotransferase (EC 2.6.1.57)
Query= CharProtDB::CH_004054 (397 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_50 Length = 398 Score = 412 bits (1058), Expect = e-119 Identities = 206/397 (51%), Positives = 271/397 (68%), Gaps = 1/397 (0%) Query: 1 MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQP 60 +F V+ DPIL L E F D R++KVNL +G+Y NE+G IP L+AV EAE AQ Sbjct: 3 LFSAVELAPRDPILGLNEAFNADTRTNKVNLGVGVYCNEEGRIPLLRAVVEAETARVAQ- 61 Query: 61 HGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFP 120 H + YLP++G+ Y A+ LLFG D P++ RV T Q +GG+GALK+GADFLK+ P Sbjct: 62 HVSRGYLPIDGIAAYDQAVQTLLFGKDSPLITSGRVITTQAVGGTGALKIGADFLKQLLP 121 Query: 121 ESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHP 180 ++ V +SDP+WENH A+F AGF V Y +YD AT+ V + LL L LP RSIV+LH Sbjct: 122 DAVVAISDPSWENHRALFETAGFPVQNYRYYDAATHDVNRSGLLEDLNALPDRSIVVLHA 181 Query: 181 CCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPAL 240 CCHNPTG DL+ + W V+ ++KA+ +PFLD+AYQGFGAG++EDA A+R A +GL Sbjct: 182 CCHNPTGVDLSPEDWKNVLAVVKAKNHVPFLDMAYQGFGAGIDEDAAAVRLFAESGLTFF 241 Query: 241 VSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN 300 S+SFSK FSLYGERVG LS++ E E + RVL Q+K +R NYS+PP GA +VAAVLN Sbjct: 242 ASSSFSKSFSLYGERVGALSIVSESKEESARVLSQVKRVIRTNYSNPPTHGASIVAAVLN 301 Query: 301 DEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVD 360 L+A W AE+ EMR RI MR ++V +L+ P +F ++ Q GMFSY+GL+ QV Sbjct: 302 SPELRAQWEAELAEMRLRIRGMRIQMVDMLAKAAPHHDFSFVARQSGMFSYSGLTVEQVT 361 Query: 361 RLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 RLR EFG+Y + +GR+CVA LN N+ V KA V+ Sbjct: 362 RLRNEFGIYALDTGRICVAALNQNNIDAVTKAIVQVI 398 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 398 Length adjustment: 31 Effective length of query: 366 Effective length of database: 367 Effective search space: 134322 Effective search space used: 134322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory