Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate Pf6N2E2_1146 Butyryl-CoA dehydrogenase (EC 1.3.99.2)
Query= reanno::Phaeo:GFF1011 (386 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1146 Length = 375 Score = 288 bits (738), Expect = 1e-82 Identities = 153/372 (41%), Positives = 230/372 (61%), Gaps = 2/372 (0%) Query: 12 EDVNALRDMVHRWAQERVRPMAQEIDQKNEFPAELWQEMGELGLLGITVPEEFGGAGMSY 71 E+ +RDM ++A+ER++P A E D+++ FP E EM ELG G+ VPE++GG Y Sbjct: 5 EEQTQIRDMARQFAEERLKPFAAEWDREHRFPREAIDEMAELGFFGMLVPEQWGGCDTGY 64 Query: 72 LAHTVAVEEIARASASVSLSYGAHSNL-CVNQIKLNGNAEQKAKYLPRLVSGEHVGALAM 130 LA+ + +EEIA + S H+++ CV +K GN EQKAK+L L SG +GA A+ Sbjct: 65 LAYAMTLEEIAAGDGACSTIMSVHNSVGCVPILKF-GNDEQKAKFLTPLASGAMLGAFAL 123 Query: 131 SEAGAGSDVVSMSLRAEKRNDHYRLNGNKYWITNGPDADTLVVYAKTDPDAGSKGMTAFL 190 +E AGSD S+ RA DHY LNG K +IT+G +A ++V+A TDP AG +G++AF+ Sbjct: 124 TEPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFI 183 Query: 191 IEKEFKGFSTSQHFDKLGMRGSNTAELVFEDVEVPFENVLGEEGKGVRVLMSGLDYERVV 250 + + G+S ++ DKLG S+T +++FED++VP N LGEEG+G ++ ++ L+ RV Sbjct: 184 VPTDSPGYSVARVEDKLGQHASDTCQILFEDLKVPVGNRLGEEGEGYKIALANLEGGRVG 243 Query: 251 LAGIGTGIMAACMDEMMPYMKERKQFGQPIGNFQLMQGKIADMYTAMNTARAYVYEVAKA 310 +A G+ A + Y +ER FG+PI Q + ++ADM T + AR V+ A Sbjct: 244 IAAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAAL 303 Query: 311 CDKGTVTRQDAAACCLYASEVAMTQAHQAVQAFGGAGYLSDNPVGRIFRDAKLMEIGAGT 370 D G +A+ L+ASE+A A+Q GG GYL+D P+ RI+RD ++ +I GT Sbjct: 304 RDSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIYEGT 363 Query: 371 SEIRRMLIGREL 382 S+I+RM+I R L Sbjct: 364 SDIQRMVISRNL 375 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 375 Length adjustment: 30 Effective length of query: 356 Effective length of database: 345 Effective search space: 122820 Effective search space used: 122820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory