Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate Pf6N2E2_2781 Urea carboxylase (EC 6.3.4.6)
Query= reanno::SB2B:6937189 (673 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2781 Length = 1226 Score = 391 bits (1005), Expect = e-113 Identities = 206/437 (47%), Positives = 291/437 (66%), Gaps = 5/437 (1%) Query: 1 MFNKLLIANRGEIACRVIRTARDMGIKTVAVYSDADRDARHVALADESFYLGESAPASSY 60 MF K+LIANRG IACR++RT R++ ++ VAVYS AD + H+ ADE+ LGE A A +Y Sbjct: 1 MFEKILIANRGAIACRILRTLRELKVQGVAVYSQADAASLHILQADEAHCLGEGAAAGTY 60 Query: 61 LRGELIIDIAKKCGAEAIHPGYGFLSENAAFARACEASGIAFVGPGSDAIDAMGSKSAAK 120 L + ++ IAK GA AIHPGYGFLSENAAFA ACEA+GIAF+GP + + G K A+ Sbjct: 61 LAVDKLLAIAKGSGATAIHPGYGFLSENAAFAEACEAAGIAFIGPTPEQLRVFGLKHTAR 120 Query: 121 LIMEKAGVPLVPGYHGDDQSDATLLAEAKKIGYPLLIKAAYGGGGKGMRIVESESELKAA 180 + + GVPL+ G D DA LLA A +IGYP+++K+ GGGG GMR+ S +EL + Sbjct: 121 DLARQHGVPLLEGTELLDSLDAALLA-ATRIGYPVMLKSTAGGGGIGMRVCRSAAELSES 179 Query: 181 IDSARREAASSFGNDKLLMERYLRQPRHVEVQVFADSQGNCVYLSDRDCSIQRRHQKVVE 240 ++ +R ++F + + +E+Y+ + RH+EVQVF D QG + L RDCS+QRR+QKV+E Sbjct: 180 FEAVKRLGQNNFSDAGVFIEKYIERARHLEVQVFGDGQGQVIALGVRDCSVQRRNQKVLE 239 Query: 241 EAPAPGLPDSLRKQMGEAAVAAAKAIDYRGAGTVEFLLDVDMS-FFFMEMNTRLQVEHPV 299 E PAP LP+ + ++ AA+ A+A++YR AGTVEF+ D D F+F+E+NTRLQVEH V Sbjct: 240 ETPAPNLPEGMADELCAAAIQLAQAVNYRSAGTVEFVFDSDAGRFYFLEVNTRLQVEHGV 299 Query: 300 TEMVTGQDLVKWQLLVAAGAQLPLEQ--HEIQIHGHAFEVRIYAEDPNNEFLPASGKLTF 357 TE V G DLV+W + +AAG PL + ++ GHA + R+YAEDP +F P+ G LT Sbjct: 300 TEQVWGVDLVRWMVQLAAGDLPPLNELGQGLKAEGHAIQARLYAEDPGRDFQPSPGLLTA 359 Query: 358 LREPE-PSRHVRIDSGVRENDVISNYYDPMIAKLIVWDESRPRALARLTRALGDYRVGGL 416 ++ P+ + +RID+ V I Y+DPMIAK+I W +R +A L +AL + + G+ Sbjct: 360 VKFPQADGKALRIDTWVEAGCQIPPYFDPMIAKVIRWAPTREQARLGLYQALDESLLYGV 419 Query: 417 KHNIEFLSNIAEHPAFA 433 + N ++L I FA Sbjct: 420 ETNRQYLQQILLDTPFA 436 Score = 45.1 bits (105), Expect = 2e-08 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 12/101 (11%) Query: 568 FLSSGSYHFREVLGQVLEETASSEDKLKAPMNGTVVTHL--------VAAGDKVSAGQGL 619 +++SG HF + A SED +V +H+ V G +V+AG L Sbjct: 1128 WIASGQAHFDSEEPAI----APSEDSPLTDGQLSVDSHIAGNLWQVQVEVGARVAAGDVL 1183 Query: 620 LVMEAMKMEYTIEAPFDGVVSEFFFAPGELVSDGTLLLALE 660 +++E+MKME + AP GVV E PG V G ++ LE Sbjct: 1184 VILESMKMEIPVLAPVAGVVREVRVQPGSAVRAGQRVVVLE 1224 Lambda K H 0.317 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1833 Number of extensions: 86 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 673 Length of database: 1226 Length adjustment: 43 Effective length of query: 630 Effective length of database: 1183 Effective search space: 745290 Effective search space used: 745290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (26.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory