Align Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate Pf6N2E2_1934 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= reanno::Pedo557:CA265_RS09125 (258 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1934 Length = 264 Score = 114 bits (285), Expect = 2e-30 Identities = 75/249 (30%), Positives = 121/249 (48%), Gaps = 6/249 (2%) Query: 12 RIATITINRPEKKNALNPQLIAELTAAFIKASEDDLVKVVILNANGDAFSAGADL----A 67 R+ +NRPEKKNAL+ ++ L A + A E+D + ++ GDAF +G DL A Sbjct: 11 RVMVAKLNRPEKKNALSESMLDSLRTALLAADENDDIGCFVITGAGDAFCSGGDLGRRAA 70 Query: 68 YLQQLQYNTFEENVADSNHLKKLFTTIYYLPKVVIAQVEGHAIAGGCGLATICDIVFATP 127 + E + ++ I K +IA V G A+ G L+ CD+ FA+ Sbjct: 71 ESAEGDPTPLERKIRLQKVTHQVALAIENFEKPLIAAVNGAAVGAGMDLSLQCDMRFASE 130 Query: 128 ESNFGYTEVKIGFVPAIVSCFLKEK-VSESIAKEILLTGKIFSAEEALKYNLINFVTNSS 186 + F +++G +P C+L + V + A E+L TG SAEEAL ++N V + Sbjct: 131 SARFAEAYIRVGLIPGNGGCYLLPRIVGTAKALELLWTGDFVSAEEALALGIVNRVFSDD 190 Query: 187 DIHQIVREFALSLCSGSSGNSLMITKQLITQTTNPLLEKCLETAVQINARVRESEDFKKG 246 ++ Q +FA L G I K+L+ Q+ L LE+ A V+ ++D+K+ Sbjct: 191 ELMQQTLDFATRLADGPPIQQRSI-KKLLYQSLRTDLRTSLESVAAQMAVVQSTDDYKEA 249 Query: 247 ISSFLNKEK 255 I ++ K K Sbjct: 250 IKAYKEKRK 258 Lambda K H 0.318 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory