Align Hydroxymethylglutaryl-CoA lyase YngG; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 (characterized)
to candidate Pf6N2E2_1040 Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)
Query= SwissProt::O34873 (299 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1040 Length = 313 Score = 234 bits (597), Expect = 2e-66 Identities = 120/285 (42%), Positives = 178/285 (62%), Gaps = 3/285 (1%) Query: 7 VTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALRDAIDVA 66 + I EVGPRDGLQ+ + TE K+ W+ L+ GL IE+ SFV PK +P + DA ++ Sbjct: 9 ILISEVGPRDGLQSVSATMPTELKLKWLTALADAGLREIEVGSFVSPKLLPQMADAAELV 68 Query: 67 KGIDREKGVTYAALVPNQRGLENALEGGINEACVFMSASETHNRKNINKSTSESLHILKQ 126 + + V ALVPN +G E A G+ + + +S SE H+ NI K+ + ++ Sbjct: 69 MHLRKRPDVFVTALVPNLKGAEAAFNAGVQKITLPISVSEPHSLANIRKTHQQVFDEVRA 128 Query: 127 VN--NDAQKANLTTRAYLSTVFGCPYEKDVPIEQVIRLSEALFEFGISELSLGDTIGAAN 184 V + + A++ + LSTVFGC + +VP + VIR++ + E G+ E+ L DT+G AN Sbjct: 129 VIALRNERFAHVEVESGLSTVFGCTIQGEVPEDDVIRMALIMAELGVDEVGLADTVGYAN 188 Query: 185 PAQVETVLEALLARFPANQIALHFHDTRGTALANMVTALQMGITVFDGSAGGLGGCPYAP 244 PAQV V L + + HFH+TRG LAN+V AL +G+T D S GG+GGCPYAP Sbjct: 189 PAQVRRVFTRLRNEIGSKAGSAHFHNTRGQGLANVVAALDVGVTTIDASQGGIGGCPYAP 248 Query: 245 GSSGNAATEDIVYMLEQMDIKTNVKLEKLLSAAKWIEEKM-GKPL 288 G+SGN TED+VY+LE MD++T V ++KL++A +W+ + + G+PL Sbjct: 249 GASGNIVTEDLVYLLESMDLRTGVDIDKLVAAREWLMQGLPGEPL 293 Lambda K H 0.315 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 313 Length adjustment: 27 Effective length of query: 272 Effective length of database: 286 Effective search space: 77792 Effective search space used: 77792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory