Align lysine/arginine/ornithine ABC transporter, periplasmic lysine/arginine/ornithine-binding protein ArgT (characterized)
to candidate Pf6N2E2_5660 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein
Query= CharProtDB::CH_003045 (260 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5660 Length = 257 Score = 230 bits (586), Expect = 3e-65 Identities = 115/264 (43%), Positives = 168/264 (63%), Gaps = 13/264 (4%) Query: 1 MKKTVLALSLLIGLGATAASYAALP-----QTVRIGTDTTYAPFSSKDAKGEFIGFDIDL 55 MKK VL LGA A S +LP + ++IG + Y PF+SK G +GFD D+ Sbjct: 1 MKKLVL-------LGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDI 53 Query: 56 GNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSR 115 GN +C+ M+VKC WV +FD LIP+LK +KIDAI+SS+SIT+ R++ + F++K Y +R Sbjct: 54 GNALCEEMKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITEDRKKSVDFTNKYYNTPAR 113 Query: 116 LIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAG 175 L+ G+ + L LKGK++GV +GS E +A + G ++ Y +Q+ IY D++AG Sbjct: 114 LVMKAGTQVSDNLAELKGKNIGVQRGSIHERFAREVLAPLGAEIKPYGSQNEIYLDVSAG 173 Query: 176 RLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKA 235 RLD + D +GFLK AGK +AF GP+ D+KYFGDG G+ +RK D LK + A Sbjct: 174 RLDGTVADATLLDDGFLKTDAGKGFAFVGPAFTDEKYFGDGIGIAVRKGDA-LKDKINGA 232 Query: 236 LTELRQDGTYDKMAKKYFDFNVYG 259 +T +R++G Y ++ KYF F++YG Sbjct: 233 ITAIRENGKYKQIQDKYFAFDIYG 256 Lambda K H 0.315 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory