Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate Pf6N2E2_2191 Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)
Query= BRENDA::Q3JP94 (395 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2191 Length = 387 Score = 217 bits (552), Expect = 5e-61 Identities = 133/375 (35%), Positives = 204/375 (54%), Gaps = 2/375 (0%) Query: 14 LDQQLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYG 73 L+ L + M+RD A+ +LAPR + A ++R+ G++GLLG T+PE+YG Sbjct: 6 LNFALGETIDMLRDQVQAFVNAELAPRAAQIDIDNLFPADMWRKFGDMGLLGITVPEEYG 65 Query: 74 GPGLDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWI 133 G GL Y+++ + E+ R + S+L + I G+ QK KYLPKL +GE I Sbjct: 66 GAGLGYLAHVVAMEEISRGSASVALSYGAHSNLCVNQINRNGNHEQKTKYLPKLISGEHI 125 Query: 134 GCFGLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLD-EDGRDE 192 G ++EPN GSD SM RA K Y L+GSK WITN P A+ +V++AK D E G Sbjct: 126 GALAMSEPNAGSDVVSMKLRADKRGDKYVLNGSKTWITNGPDANTYVIYAKTDLEKGPHG 185 Query: 193 IRGFILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENILPHVK-GLRGPFTCLN 251 I FI+E+ KG S K+G+R S T E+ D+ VPE+NIL + G++ + L+ Sbjct: 186 ITAFIVERDWKGFSRSNKFDKLGMRGSNTCELFFDDVEVPEDNILGALNGGVKVLMSGLD 245 Query: 252 SARYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVL 311 R ++ G G ++C + Y+ DRKQFG+ + QLIQ K+ADM T++ + Sbjct: 246 YERVVLSGGPTGIMQACMDLIVPYIHDRKQFGQSIGEFQLIQGKVADMYTQLNASRAYLY 305 Query: 312 RLGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVN 371 + + + G + + + S +A +A A +LGGNG +EF R L + ++ Sbjct: 306 AVAQACERGETTRKDAAGVILYSAERATQMALDAIQILGGNGYINEFPAGRLLRDAKLYE 365 Query: 372 TYEGTHDIHALILGR 386 GT +I +++GR Sbjct: 366 IGAGTSEIRRMLIGR 380 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 387 Length adjustment: 31 Effective length of query: 364 Effective length of database: 356 Effective search space: 129584 Effective search space used: 129584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory