Align ABC transporter for L-Lysine, permease component 2 (characterized)
to candidate Pf6N2E2_5662 Arginine/ornithine ABC transporter, permease protein AotM
Query= reanno::pseudo5_N2C3_1:AO356_09910 (229 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5662 Length = 232 Score = 213 bits (542), Expect = 3e-60 Identities = 111/221 (50%), Positives = 155/221 (70%), Gaps = 1/221 (0%) Query: 2 NWDVIIKWLPKLAQGATLTLELVAIAVIAGLLLAIPLGIARSSRLWQVRALPYAYIFFFR 61 +++VI + LP G TL+L+A+++ GLL A+PLG+ R S+ V + Y + R Sbjct: 4 DYNVIYEALPLYFSGLLTTLKLLALSLFFGLLAALPLGLMRVSKQPIVNMTAWLYTYVIR 63 Query: 62 GTPLLVQLFLVYYGLAQFDAVRSSALWPYLRDPFWCATVTMTLHTAAYIAEILRGAIQAI 121 GTP+LVQLFL+YYGLAQF VR S LWP+L +CA + ++T+AY AEI+ G+++A Sbjct: 64 GTPMLVQLFLIYYGLAQFAIVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRAT 123 Query: 122 PKGEIEAARALGMSRPKALFYIMLPRAARIGLPAYSNEVILMLKASALASTVTLLELTGM 181 GEIEAA+A+GMSR K I+LP A R LP YSNEVI+ML+ ++LAS VTL+++TG Sbjct: 124 SNGEIEAAKAMGMSRYKLYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGA 183 Query: 182 ARTIIARTYLPVEIFFAAGMFYLLMSFLLVQGFKQLE-RWL 221 ART+ A+ YLP E + AG+FYL ++F+LV+ FK E RWL Sbjct: 184 ARTVNAQYYLPFEAYITAGVFYLCLTFILVRLFKLAERRWL 224 Lambda K H 0.331 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 232 Length adjustment: 23 Effective length of query: 206 Effective length of database: 209 Effective search space: 43054 Effective search space used: 43054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory