Align The lysine specific transporter, LysP of 488 aas and 12 TMSs (characterized)
to candidate Pf6N2E2_5459 D-serine/D-alanine/glycine transporter
Query= TCDB::K7VV21 (488 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5459 Length = 473 Score = 309 bits (791), Expect = 2e-88 Identities = 180/462 (38%), Positives = 268/462 (58%), Gaps = 23/462 (4%) Query: 13 VKRGLKSRHVSMIALGGTIGTGLFLTSGDVIHTAGPFGALTAYVLIGAMVYFLMTSLGEM 72 +KR L RH+ ++ALG IG GLFL S I AGP + +Y++ G + +M +LGEM Sbjct: 18 LKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGP-AIMLSYIIGGLAILVIMRALGEM 76 Query: 73 ATYLPTSGSFSDYGTRYVDPAFGFALGWNYWLNWAITVAVDLTAVALCIKFWLPDVPSWI 132 A + P +GSFS Y Y+ P GF GWNYW W +T ++TAVA+ + W PDVP WI Sbjct: 77 AVHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITAVAVYMGIWFPDVPRWI 136 Query: 133 FSLIALIIVFSINALSVKTFGETEYWLSAIKITVVVLFLIIGFLSIFGIMGGHIDVAKNL 192 ++L AL+ + SIN ++VK FGE E+W + IKI V ++ ++IG + I G+ VA + Sbjct: 137 WALAALVSMGSINLIAVKAFGEFEFWFALIKI-VTIIAMVIGGVGIIAFGFGNDGVALGI 195 Query: 193 S-VGNHGFVGGLGSFTTGG--GILGVLLVAGFSFQGTELLGITAGEAENPEKSIPKAMNS 249 S + H G F G G+L L + F++ G E++G+TAGEA+NP+K+IP A+ S Sbjct: 196 SNLWTH------GGFMPNGVQGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPNAIGS 249 Query: 250 IFWRILVFYILSIFVMAAIIPFTDPHLVGGNSAAQSPFTIVFERVGFSIAASIMNAVVLT 309 +FWRIL+FY+ ++FV+ +I P+ + G SPF + FER+G AA I+N VV+T Sbjct: 250 VFWRILLFYVGALFVILSIYPWNEIGTQG------SPFVMTFERLGIKTAAGIINFVVIT 303 Query: 310 SVVSAANSGMYASTRMLYSLAKDGGAPTIFSKTSKNGIPFIALLATTAVALL-TFLTSIY 368 + +S+ N G++++ RMLYSLA++G AP F+ TS NG+P ALL + A LL L + Sbjct: 304 AALSSCNGGIFSTGRMLYSLAQNGQAPAGFATTSANGVPRRALLLSIAALLLGVLLNYLV 363 Query: 369 GVSFFTFLVSASGLTGFIAWIGIAISHFRFRRAYVAQGKDVKKLPYHAKLFPFGPILALI 428 F ++ S + W+ I ++ +FR++ A + L Y L+P LAL Sbjct: 364 PEKVFVWVTSIATFGAIWTWVMILLAQLKFRKSLSASER--AALKYRMWLYPVSSYLALA 421 Query: 429 MTVLVTLGQDPMLLFGKTWVQGVVMYAAIPLFFILYLGYKFK 470 VLV M F T V V A + L +L+ +K + Sbjct: 422 FLVLVV---GLMAYFPDTRVALYVGPAFLVLLTVLFYVFKLQ 460 Lambda K H 0.326 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 583 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 473 Length adjustment: 34 Effective length of query: 454 Effective length of database: 439 Effective search space: 199306 Effective search space used: 199306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory