Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate Pf6N2E2_1960 Various polyols ABC transporter, ATP-binding component
Query= uniprot:Q6MNM2 (347 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1960 Length = 365 Score = 296 bits (759), Expect = 4e-85 Identities = 164/356 (46%), Positives = 219/356 (61%), Gaps = 21/356 (5%) Query: 1 MAKIQFSNIKKSFGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTI 60 MA ++ N+KK F ++KGIDL++ EF+V VGPSGCGKSTLLR +AGLE SGTI Sbjct: 1 MATLKIENLKKGFEGLSIIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGTI 60 Query: 61 SIDGKKINDIEPQNRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISEL 120 +DG+ I ++ P RD+AMVFQ+YALYPHMTV +N+ F L L ++ ++V E + + Sbjct: 61 ELDGRDITEVTPAKRDLAMVFQTYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAARI 120 Query: 121 LQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLH 180 L++ LLDRKPK+LSGGQRQRVA+GRA+ R + LFDEPLSNLDA LR Q RLE+ RLH Sbjct: 121 LELGSLLDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSRLH 180 Query: 181 HNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPEMN 240 ++TMIYVTHDQ+EA TL ++ VL G IEQIG+P E+YH P N F+A F+G+P+M Sbjct: 181 KELQATMIYVTHDQVEAMTLATKVVVLNAGRIEQIGSPLELYHHPANLFVAGFLGTPKMG 240 Query: 241 FLEGAV-LEKIPWPEARKAD-QILGIRPDAFALNQGPLGTQEVALG-------------- 284 FL+ V E R A L I D+ AL+ G Q V +G Sbjct: 241 FLQATVHAVHASGVEVRFASGTTLLIPRDSSALSVG----QSVTIGIRPEHLTLSAEGQV 296 Query: 285 DFQIDISENLGGQQMLHGTL-AGNNVRILVDSMDNFSMKQTLPLKIDLTKAHLFDK 339 D++E LG H + +G ++ + V L +D+ HLFD+ Sbjct: 297 PVTTDVTERLGSDTFCHVNVDSGESLTVRVQGDCEVPYAARRYLTLDVAHCHLFDE 352 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 365 Length adjustment: 29 Effective length of query: 318 Effective length of database: 336 Effective search space: 106848 Effective search space used: 106848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory