GapMind for catabolism of small carbon sources

 

Aligments for a candidate for susB in Pseudomonas fluorescens FW300-N2E2

Align α-1,4-glucosidase (MalA) (EC 3.2.1.20) (characterized)
to candidate Pf6N2E2_2118 Trehalose synthase (EC 5.4.99.16)

Query= CAZy::CAA55409.1
         (549 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2118 Trehalose synthase
           (EC 5.4.99.16)
          Length = 1114

 Score =  265 bits (676), Expect = 9e-75
 Identities = 169/542 (31%), Positives = 275/542 (50%), Gaps = 60/542 (11%)

Query: 5   WWKEAVAYQVYPRSFNDSNNDGIGDLPGVIEKLDYLNELGIDVIWLSPMYKSPNDDNGYD 64
           W+K+AV YQV+ +S+ DSNNDGIGD PG+IEKLDY+ +LG++ IWL P Y SP  D+GYD
Sbjct: 16  WYKDAVIYQVHVKSYFDSNNDGIGDFPGLIEKLDYIADLGVNTIWLLPFYPSPRRDDGYD 75

Query: 65  ISDYTDIMDEFGTMDDFNLLLESVHQRGMKLILDLVVNHTSDEHPWFIESKSSKDNPK-R 123
           I++Y  +  ++GTM D    +   H+R +++I +LV+NHTSD+HPWF  ++ +K   K R
Sbjct: 76  IAEYRGVSADYGTMADARRFIAEAHKRNLRVITELVINHTSDQHPWFQRARKAKPGSKAR 135

Query: 124 DWYIWQEPKPDGSEPNNWESIF---NGSTWEYDDTTGEYYFHLFSKKQPDLNWGNKEVRH 180
           D+Y+W +   D  + +    IF     S W +D   G+Y++H F   QPDLN+ N +V  
Sbjct: 136 DFYVWSD---DDHKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQPDLNFDNPQVIK 192

Query: 181 AIFEMMNWWFEKGIDGFRVDAITHIKKSFEAGDLPVPEGKTYAPAF--DVDMNQPGIQSW 238
           A+  +M +W + GIDG R+DAI ++ +     +  +PE          ++D N P     
Sbjct: 193 AVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKLIRAEIDANYP----- 247

Query: 239 LQEMKEKSLSQYDIMTVGEANGVNPENA------VEWVGENEGKFNMIFQFEHLGLWNTG 292
                       D M + EAN   PE+       V+  G N  + +M F F  +      
Sbjct: 248 ------------DRMLLAEANQW-PEDTQLYFGDVDAQGMNGDECHMAFHFPLMPRMYMA 294

Query: 293 DSKFDVKAYKDVLNRWQKQLENIGWNALFIENHDQPRRVSTWGDDQNY-W-YESATSHAI 350
            ++ D     D+L +  +   N  W A+F+ NHD+         +++Y W Y +A   A 
Sbjct: 295 LAQEDRFPITDILRQTPEIPANCQW-AIFLRNHDELTLEMVTDKERDYLWNYYAADRRAR 353

Query: 351 VY--FLQQGTPFIYQGQEIGMTNYPFESVETFNDVAVVNEYNIVKSQNGDVSALLEKHKM 408
           +     ++  P + + +           VE  N + +++         GD   + +   +
Sbjct: 354 INLGIRRRLAPLVERDR---------RRVELLNSL-LLSMPGTPTLYYGDEIGMGDNIYL 403

Query: 409 ENRDNSRTPMQWNNQTNSGFSEHSPWFPVNP-------NYKTINVADQQQDPNSILNFYK 461
            +RD  RTPMQW+   N GFS   P   V P        Y+++NV  Q  DP+S+LN+ +
Sbjct: 404 GDRDGVRTPMQWSIDRNGGFSRADPASLVLPPIMDPQYGYQSVNVETQAGDPHSLLNWTR 463

Query: 462 SLITLKKSDDIYTYGTFDLVDKNNEQVFAYTRTL-----NNKKVLIVANLTNQTATFKYD 516
            ++ ++K    +  GT  ++  +N ++ AYTR        ++ +L VAN++      + D
Sbjct: 464 RMLAVRKQSKAFGRGTLKMLSPSNRRILAYTREYTGPDGKHEIILCVANVSRSAQAAELD 523

Query: 517 NS 518
            S
Sbjct: 524 LS 525


Lambda     K      H
   0.315    0.133    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1583
Number of extensions: 91
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 549
Length of database: 1114
Length adjustment: 41
Effective length of query: 508
Effective length of database: 1073
Effective search space:   545084
Effective search space used:   545084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory