Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, permease component 2 (characterized)
to candidate Pf6N2E2_1962 Various polyols ABC transporter, permease component 1
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3041 (299 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1962 Length = 280 Score = 517 bits (1332), Expect = e-151 Identities = 260/280 (92%), Positives = 272/280 (97%) Query: 20 VSPSVALLLLWMIVPLGMTVYFSTIRYNLLNPGENEFVGLENFTYFLTDSGFLPGATNTL 79 VSPSVALLLLWMIVPL MTVYFS IRYNLLNPGENEFVGLENF YF+TDSGFLPGA NTL Sbjct: 1 VSPSVALLLLWMIVPLAMTVYFSVIRYNLLNPGENEFVGLENFAYFVTDSGFLPGALNTL 60 Query: 80 LLVGSVLLISVVFGVLISALLEASEFFGRGIVRVMLISPFFIMPTVGALIWKNLIFHPVS 139 +LVGSVLLISV+FGVLI+ALLEASEFFGRGIVRV+LISPFFIMPTVG+LI+KNLIFHPVS Sbjct: 61 ILVGSVLLISVIFGVLIAALLEASEFFGRGIVRVLLISPFFIMPTVGSLIFKNLIFHPVS 120 Query: 140 GILAYVWKLFGAQPVDWLAHYPLLSIIIIVSWQWLPFAILILMTAMQSLDQEQKEAARLD 199 GILA VWK FGAQPVDWLAHYPL SII+IVSWQWLPFAIL+LMTAMQSLDQEQKEAARLD Sbjct: 121 GILAAVWKFFGAQPVDWLAHYPLFSIIVIVSWQWLPFAILLLMTAMQSLDQEQKEAARLD 180 Query: 200 GAGPIAIFWHLTLPHLARPIAVVVMIETIFLLSVFAEIFTTTNGGPGYASTNLAYLIYNQ 259 GAG +AIFWHLTLPHLARPIAVVVMIETIFLLSVFAEIFTTTNGGPG+ASTNLAYLIYNQ Sbjct: 181 GAGALAIFWHLTLPHLARPIAVVVMIETIFLLSVFAEIFTTTNGGPGFASTNLAYLIYNQ 240 Query: 260 ALVQFDVGMASAGGLIAVVIANIAAIILVRMIGKNLTDKA 299 ALVQFDVGMASAGGLIAVVIANIAAI+LVRMIGKNLTDKA Sbjct: 241 ALVQFDVGMASAGGLIAVVIANIAAIVLVRMIGKNLTDKA 280 Lambda K H 0.328 0.142 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 280 Length adjustment: 26 Effective length of query: 273 Effective length of database: 254 Effective search space: 69342 Effective search space used: 69342 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory