Align ABC transporter for D-mannitol and D-mannose, permease component 2 (characterized)
to candidate Pf6N2E2_1648 Maltose/maltodextrin ABC transporter, permease protein MalG
Query= reanno::pseudo3_N2E3:AO353_25890 (276 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1648 Length = 280 Score = 153 bits (386), Expect = 5e-42 Identities = 93/277 (33%), Positives = 147/277 (53%), Gaps = 8/277 (2%) Query: 7 RRLQSLLLGTLAWA-IAILIF---FPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYLHV 62 R L+ LL W I IL+ FP ++ ++TS K F +I P NY V Sbjct: 4 RLLKKALLRAGFWCLIGILLLYAVFPFYYAIVTSLKPSSALFQVS-YWIDNPDFSNYAAV 62 Query: 63 NERSGYFSFAWNSVVISFSATALCLLIAVPAAYSMAFYETQRTKGTLLWMLSTKMLPPVG 122 ++ + NS+V++ AL LL+++ AAY++ + + L+ +L M P V Sbjct: 63 LGQASFLRAIGNSLVVALCVVALALLLSLTAAYALGRVKFRGRGVVLMMVLGVSMFPQVA 122 Query: 123 VLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMIYTYFKDIPKDILEAARLDGATLW 182 VL ++ + ++ GL +T ALI+ YT+ LP VW++ T+ +P ++ EAA +DGA+ W Sbjct: 123 VLSGLFEVIRALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPW 182 Query: 183 QEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLT---SSKAAPLTALIASYSSPEGL 239 + RVLLP+ L +T LL+ I WNE ++L T S + P+ + S SP L Sbjct: 183 VTLTRVLLPLLWPALVTTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALISGGSPHEL 242 Query: 240 FWAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK 276 W L A S L P++I I Q+++V GL+ GA+K Sbjct: 243 PWGLLMAASVLVTVPLVILVLIFQRRIVSGLTAGALK 279 Lambda K H 0.327 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 280 Length adjustment: 25 Effective length of query: 251 Effective length of database: 255 Effective search space: 64005 Effective search space used: 64005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory