GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS03640 in Pseudomonas fluorescens FW300-N2E2

Align Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale)
to candidate Pf6N2E2_1008 Inositol transport system ATP-binding protein

Query= uniprot:D8IZC7
         (521 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1008 Inositol transport
           system ATP-binding protein
          Length = 485

 Score =  342 bits (878), Expect = 1e-98
 Identities = 201/470 (42%), Positives = 290/470 (61%), Gaps = 14/470 (2%)

Query: 37  LMGENGAGKSTLMKVLSGVHAPD--QGEILLDGRPVALRD-PGASRAAGINLIYQELAVA 93
           L+GENGAGKST++K+L+G    D  QG +  +G  +   D P   +  GI  IYQE  + 
Sbjct: 1   LLGENGAGKSTILKILAGAQPADAGQGSLEFNGHVLGEHDTPIRRQEVGIITIYQEFNLI 60

Query: 94  PNISVAANVFMGSELRTRLGLIDHAAMRSRTDAVLRQLGAGFGASDLAGRLSIAEQQQVE 153
            ++SVA N+++G E   R G +D   M S    VL  LG       +  +LS+AEQQ VE
Sbjct: 61  ADMSVAENMYLGRE-PLRHGFVDWKQMFSDAQHVLDDLGLHITPRTMVRKLSVAEQQMVE 119

Query: 154 IARALVHRSRIVIMDEPTAALSERETEQLFNVVRRLRDEGLAIIYISHRMAEVYALADRV 213
           IA+AL   ++++IMDEPTAALS RE ++L  ++  L+ +G++IIY+SH++ EV A  DR 
Sbjct: 120 IAKALTMNAKLIIMDEPTAALSGREVDKLHEIITDLKAKGISIIYVSHKLNEVKACCDRY 179

Query: 214 TVLRDGSFVGELVRDEIDSERIVQMMVGRSLSEFYQHQRIAPADAAQLPTVMQVRALAGG 273
           T+ RDG+++      ++  + IV++MVGR + EF +           L      R  AGG
Sbjct: 180 TIFRDGAYITSGDVCDVSVDDIVRLMVGRDV-EFVRKPLTGAPGEVMLKVQSVSRTAAGG 238

Query: 274 -------KIRPASFDVRAGEVLGFAGLVGAGRTELARLLFGADPRSGGDILLEGRPVH-I 325
                   +   S DVRAGE++GFAGLVGAGRTELAR++FGAD    G I + GR V   
Sbjct: 239 GRSLHATPLLDMSVDVRAGEIVGFAGLVGAGRTELARVIFGADGCDEGMIYVNGRQVSPF 298

Query: 326 DQPRAAMRAGIAYVPEDRKGQGLFLQMAVAANATMNVASRHTRLGL-VRSRSLGGVARAA 384
             PR  + AG+A VPEDRK Q  FL  ++  N ++       R G+ +  R+   + +  
Sbjct: 299 KSPREGIAAGVALVPEDRKQQACFLSHSIRWNMSLPSLGGLQRWGMFIDDRAETQLIQDY 358

Query: 385 IQRLNVKVAHPETPVGKLSGGNQQKVLLARWLEIAPKVLILDEPTRGVDIYAKSEIYQLV 444
            +RL +K+++    +G LSGGNQQKV+LAR + + PKVLI+DEPTRG+D+ AK+E++QL+
Sbjct: 359 QKRLRIKMSNDSVAIGTLSGGNQQKVILARCMALKPKVLIVDEPTRGIDVGAKAEVHQLL 418

Query: 445 HRLASQGVAVVVISSELPEVIGICDRVLVMREGMITGELAGAAITQENIM 494
             +A  GVAV+VISSELPEV+ + DR++  REG ITG ++    T+E +M
Sbjct: 419 FDMARAGVAVIVISSELPEVMAVSDRIVTFREGQITGIVSADEATEELLM 468



 Score = 89.4 bits (220), Expect = 3e-22
 Identities = 67/238 (28%), Positives = 115/238 (48%), Gaps = 13/238 (5%)

Query: 22  LSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVHAPDQGEILLDGRPVA-LRDPGASRA 80
           L DM + +R GEI    G  GAG++ L +V+ G    D+G I ++GR V+  + P    A
Sbjct: 247 LLDMSVDVRAGEIVGFAGLVGAGRTELARVIFGADGCDEGMIYVNGRQVSPFKSPREGIA 306

Query: 81  AGINLIYQEL---------AVAPNISVAANVFMGSELRTRLGLIDHAAMRSRTDAVLRQL 131
           AG+ L+ ++          ++  N+S+ +   +G   R  + + D A  +   D   R  
Sbjct: 307 AGVALVPEDRKQQACFLSHSIRWNMSLPS---LGGLQRWGMFIDDRAETQLIQDYQKRLR 363

Query: 132 GAGFGASDLAGRLSIAEQQQVEIARALVHRSRIVIMDEPTAALSERETEQLFNVVRRLRD 191
                 S   G LS   QQ+V +AR +  + +++I+DEPT  +      ++  ++  +  
Sbjct: 364 IKMSNDSVAIGTLSGGNQQKVILARCMALKPKVLIVDEPTRGIDVGAKAEVHQLLFDMAR 423

Query: 192 EGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIVQMMVGRSLSEFYQ 249
            G+A+I IS  + EV A++DR+   R+G   G +  DE   E ++  M     S F Q
Sbjct: 424 AGVAVIVISSELPEVMAVSDRIVTFREGQITGIVSADEATEELLMARMAQGVSSSFSQ 481


Lambda     K      H
   0.320    0.135    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 675
Number of extensions: 33
Number of successful extensions: 11
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 521
Length of database: 485
Length adjustment: 34
Effective length of query: 487
Effective length of database: 451
Effective search space:   219637
Effective search space used:   219637
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory