Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate Pf6N2E2_3425 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3425 Length = 328 Score = 273 bits (698), Expect = 4e-78 Identities = 146/315 (46%), Positives = 205/315 (65%), Gaps = 1/315 (0%) Query: 4 LLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGR 63 +L+V +L V E V VD +S+ L KGE LG+VGESGSGK+++ +L+RL+ Sbjct: 5 VLHVEDLSVIAGHGEDEVTLVDRVSFDLAKGEILGLVGESGSGKTMACRALMRLLPSANL 64 Query: 64 IVDGEAIFL-GKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRL 122 V G+A+ L G+DLL L++ +R IRG+ + +IFQNP + L+P++R+G Q+ E I H+ Sbjct: 65 RVQGKALRLAGEDLLSLDEAGMRGIRGRRLGMIFQNPGSHLDPLMRIGEQIGEGIRLHQG 124 Query: 123 MKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPT 182 EAR +AI++L +VGIP+ R +YP +FSGGMRQR MIA+AL C+P++LIADEPT Sbjct: 125 ASKREARAKAIDVLRQVGIPDPLTRVDSYPHEFSGGMRQRAMIAVALGCNPQVLIADEPT 184 Query: 183 TALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEI 242 TALDVT+QAQI+ LL +L+++ G+S+I ITHDL + CD I MYAG++ E ++ Sbjct: 185 TALDVTVQAQILRLLLDLRDQRGLSIIMITHDLGIVAQTCDSIAVMYAGRLCEHGNKLDL 244 Query: 243 LKTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQREE 302 L P HPYT L++ + L I G PP PSGC+F+PRC C R Sbjct: 245 LAHPRHPYTAALIDCQPATSAGHAMLKTIAGQPPLLDALPSGCRFNPRCLQQGSQCTRLL 304 Query: 303 PPLVNISENHRVACH 317 P + +E HRVACH Sbjct: 305 PQMQVTAEAHRVACH 319 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 328 Length adjustment: 28 Effective length of query: 296 Effective length of database: 300 Effective search space: 88800 Effective search space used: 88800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory