Align Inositol ABC transporter, periplasmic inositol-binding protein IbpA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate Pf6N2E2_1006 Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)
Query= TCDB::B8H228 (326 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1006 Length = 177 Score = 180 bits (456), Expect = 3e-50 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 1/178 (0%) Query: 149 MADWVVKTYPAGARVVVITNDPGSSSSIERVKGVHDGLAAGGPAFKIVTEQTANSKRDQA 208 M DWVVK P GA VV+IT GS+++++R KGVH L A G FK+V EQ+ + R +A Sbjct: 1 MGDWVVKNLPTGANVVLITGQIGSTTAMDRAKGVHQSLTAAGSKFKLVAEQSGEADRAKA 60 Query: 209 LTVTQNILTSMRDTPPDVILCLNDDMAMGALEAVRAAGLDSAKVKVIGFDAIPEALARIK 268 ++V +NILT+ PPDVI+C DM +GA+EAVR GL S K+K+IG+DA PE L IK Sbjct: 61 MSVVENILTASAGNPPDVIICSTGDMTLGAVEAVRGMGL-SDKIKIIGYDAYPEVLKSIK 119 Query: 269 AGEMVATVEQNPGLQIRTALRQAVDKIKSGAALKSVSLKPVLITSGNLTEASRIGEMK 326 AGE+ VEQ+P QIRTALR AV+ I++G ++SV++ P ++T NL +A + +K Sbjct: 120 AGEITGIVEQSPSKQIRTALRLAVENIRNGTKIESVTITPFMVTRENLDQAEQFSAIK 177 Lambda K H 0.315 0.130 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 177 Length adjustment: 23 Effective length of query: 303 Effective length of database: 154 Effective search space: 46662 Effective search space used: 46662 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory