Align inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate Pf6N2E2_1002 Myo-inositol 2-dehydrogenase (EC 1.1.1.18)
Query= BRENDA::O68965 (330 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 Length = 333 Score = 279 bits (713), Expect = 8e-80 Identities = 150/330 (45%), Positives = 206/330 (62%), Gaps = 4/330 (1%) Query: 3 VRFGLLGAGRIGKVHAKAVSGNADARLVAVADAFPAAAEAIAGAYGCEVRT--IDAIEAA 60 +R +LGAGRIGK+HA V+ N +LV +AD + A+A GCE AIE Sbjct: 2 LRIAVLGAGRIGKIHAANVATNPRTKLVVIADPWKEGVNALAMQLGCEAAYDYASAIERT 61 Query: 61 ADIDAVVICTPTDTHADLIERFARAGKAIFCEKPIDLDAERVRACLKVVSDTKAKLMVGF 120 D+DAV I TPT+ H +L+ + R GK + CEKPID+D ER +A + + ++M+ F Sbjct: 62 -DVDAVFIGTPTEFHIELMLQAVRLGKPVICEKPIDMDYERAKAAVDELERLNGRVMLAF 120 Query: 121 NRRFDPHFMAVRKAIDDGRIGEVEMVTITSRDPSAPPVDYIKRSGGIFRDMTIHDFDMAR 180 NRRFDP ++ +R+AIDDG IG V V ITSRDP+ Y++ SGGIFRDMTIHDFDMAR Sbjct: 121 NRRFDPDYLRLRRAIDDGEIGVVRQVIITSRDPALAARAYLETSGGIFRDMTIHDFDMAR 180 Query: 181 FLLGEEPVSVTATAAVLIDKAIGDAGDYDSVSVILQTASGKQAIISNSRRATYGYDQRIE 240 LLGEEPV V A + L+D + DYDSV V+++TASG+Q I+ R A YG+DQR+E Sbjct: 181 SLLGEEPVEVFAVGSRLVDPTLESIPDYDSVMVLMRTASGRQCHINCCREAVYGFDQRLE 240 Query: 241 VHGSKGAVAAENQRPVSIEIATGDGY-TRPPLHDFFMTRYTEAYANEIESFIAAIEKGAE 299 V GSKG + EN R S+ + PL +FF+ R+ ++Y E+ SF+ A+E + Sbjct: 241 VSGSKGMLLNENHRTNSVRRYGAEATDVADPLLNFFLERHADSYKIELNSFLDAVENNSP 300 Query: 300 IAPSGNDGLAALALADAAVRSVAEKRQISI 329 + + DGL AL LA+ A S + + + Sbjct: 301 MPATPRDGLRALRLANCASESAETGKVVRV 330 Lambda K H 0.320 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 333 Length adjustment: 28 Effective length of query: 302 Effective length of database: 305 Effective search space: 92110 Effective search space used: 92110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Pf6N2E2_1002 (Myo-inositol 2-dehydrogenase (EC 1.1.1.18))
to HMM TIGR04380 (iolG: inositol 2-dehydrogenase (EC 1.1.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04380.hmm # target sequence database: /tmp/gapView.1918555.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04380 [M=330] Accession: TIGR04380 Description: myo_inos_iolG: inositol 2-dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-119 382.0 0.0 1.1e-118 381.8 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 Myo-inositol 2-dehydrogenase (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 Myo-inositol 2-dehydrogenase (EC 1.1.1.18) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 381.8 0.0 1.1e-118 1.1e-118 1 330 [] 1 329 [. 1 329 [. 0.98 Alignments for each domain: == domain 1 score: 381.8 bits; conditional E-value: 1.1e-118 TIGR04380 1 klkigiiGaGRigkvHaenlakkvpeaelaavvdvaeeaakelaeklgieevvedveailedpe 64 +l+i+++GaGRigk+Ha n+a++ p+++l+ ++d+ +e +++la +lg e++ d+++++e+++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 1 MLRIAVLGAGRIGKIHAANVATN-PRTKLVVIADPWKEGVNALAMQLGC-EAAYDYASAIERTD 62 689********************.*************************.77788********* PP TIGR04380 65 vdAvliasptdtHaeliveaakagkhifcEKPidldleeikealkavekagvklqiGfnRRFDa 128 vdAv+i +pt++H+el+ +a++ gk ++cEKPid+d e++k+a++++e+ + ++++ fnRRFD+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 63 VDAVFIGTPTEFHIELMLQAVRLGKPVICEKPIDMDYERAKAAVDELERLNGRVMLAFNRRFDP 126 **************************************************************** PP TIGR04380 129 nfaevkklveagkiGklellritsrDPapppveyvkvsGglflDmtiHDfDmarfllgseveev 192 + ++++++++g+iG ++++ itsrDPa+++++y+++sGg+f+DmtiHDfDmar llg+e++ev lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 127 DYLRLRRAIDDGEIGVVRQVIITSRDPALAARAYLETSGGIFRDMTIHDFDMARSLLGEEPVEV 190 **************************************************************** PP TIGR04380 193 yaagsvlvdpeleeagdvdtavvvlkfengalaviensrraayGYdqrvEvfGskGslraendt 256 +a+gs+lvdp+le + d+d+++v++++++g+ ++i+ +r+a+yG+dqr+Ev GskG+l en++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 191 FAVGSRLVDPTLESIPDYDSVMVLMRTASGRQCHINCCREAVYGFDQRLEVSGSKGMLLNENHR 254 **************************************************************** PP TIGR04380 257 estvvlsdeegv.raekpenfFleRyaeayraeikafvdailedkevsvtaeDglkalklalaa 319 +++v+++++e + +a+ nfFleR+a++y+ e+++f+da++++++++ t +Dgl+al+la+ a lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 255 TNSVRRYGAEATdVADPLLNFFLERHADSYKIELNSFLDAVENNSPMPATPRDGLRALRLANCA 318 *********9995677889********************************************* PP TIGR04380 320 krsleegravk 330 ++s+e+g++v+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 319 SESAETGKVVR 329 *******9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 23.04 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory