Align Inositol 2-dehydrogenase 2; EC 1.1.1.18; Myo-inositol 2-dehydrogenase 2; MI 2-dehydrogenase 2 (uncharacterized)
to candidate Pf6N2E2_885 Myo-inositol 2-dehydrogenase (EC 1.1.1.18)
Query= curated2:A4FID1 (339 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_885 Length = 342 Score = 250 bits (638), Expect = 4e-71 Identities = 145/341 (42%), Positives = 194/341 (56%), Gaps = 14/341 (4%) Query: 1 MTMNIGVIGCGLMGADHIRTLTTAVSGARVAAVNDADEGRAAGAAAEAEGARVHSDPFGL 60 M++ I VIG G+MG DH R + + GA + V DA RA A A V +DP Sbjct: 1 MSIRIAVIGAGIMGEDHARIIAQDLPGATLHVVCDASPERAKLIADRYGAADVSTDPLFT 60 Query: 61 IDDAEVDAVVVASADETHEEFALACVRAGKPVLCEKPLATTSEACLRVVEAEMRGGRPLV 120 + ++VDA+++AS DETH +A + AGKP LCEKPL+ + + CL V++ E GR V Sbjct: 61 LSRSDVDAIIIASPDETHAVLTMAAIEAGKPALCEKPLSQSPDQCLAVIDKEASRGRQFV 120 Query: 121 QVGFMRRFDPSYLEMKRVLDSGRIGRALMLHSVHRNAGYPPALPDSALITGTGVHDIDIA 180 Q+GFMRRFDPSY EMK L G IGRA+M+H+ HRN P I+ + H+ D+A Sbjct: 121 QLGFMRRFDPSYREMKSALSDGVIGRAVMMHNFHRNVEAPANFSGQMAISNSAPHEFDVA 180 Query: 181 RWLLGQEIVTATAHTPRRS---GLARPDFQDTRFLVLETENGVLVDVEIFVNAGYGYDVR 237 R +L E V + P + G+ P F+VLET G LV++EI NA YGYDVR Sbjct: 181 RHVLDTEYVAISVFQPTHTSEDGVGAP-----VFMVLETREGHLVNIEINNNAHYGYDVR 235 Query: 238 GELVGELGSISLHPP--ATLTTRYEGLEGRPVARDFRPRFQDAYRNELQAWVTAGASGE- 294 GELVGE GS+ L+ P T +G E A D+RPRF DAYR + +A+V +G Sbjct: 236 GELVGERGSVQLNTPVHTRFNTCLQGFE--RYAADWRPRFADAYRLQNKAFVAFINTGRF 293 Query: 295 -VRGATAWDGYASAAVAEACLHSVATGSTAPVEIAPQPALY 334 V A AWDGY +A VA+A + ++ + P LY Sbjct: 294 PVHAANAWDGYCAAIVAQAGIEALNQRRRVVLPTLEAPPLY 334 Lambda K H 0.319 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 342 Length adjustment: 28 Effective length of query: 311 Effective length of database: 314 Effective search space: 97654 Effective search space used: 97654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory