Align Major myo-inositol transporter IolT (characterized)
to candidate Pf6N2E2_883 Major myo-inositol transporter IolT
Query= SwissProt::O34718 (473 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_883 Length = 472 Score = 471 bits (1211), Expect = e-137 Identities = 234/444 (52%), Positives = 315/444 (70%), Gaps = 2/444 (0%) Query: 10 FLRTIILVSTFGGLLFGYDTGVLNGALPYMGEPDQLNLNAFTEGLVTSSLLFGAALGAVF 69 +L+ I ++TFGGLLFG+DTGV+NGAL YM D L L FTEGLV S+LL GA +GA+F Sbjct: 27 YLQKITWIATFGGLLFGFDTGVINGALLYM--KDDLGLTPFTEGLVASALLIGAMMGALF 84 Query: 70 GGRMSDFNGRRKNILFLAVIFFISTIGCTFAPNVTVMIISRFVLGIAVGGASVTVPAYLA 129 GR+SD GRR+ ILFLAV+FF+ + C AP + VM+ +RF LG+AVGGASV VPAYL+ Sbjct: 85 SGRLSDLKGRRRIILFLAVVFFLGALACALAPTLDVMVAARFTLGLAVGGASVVVPAYLS 144 Query: 130 EMSPVESRGRMVTQNELMIVSGQLLAFVFNAILGTTMGDNSHVWRFMLVIASLPALFLFF 189 EM+P RGR++T+NELMIV+GQ LAF NA LG D VWR+ML +A+LPA+ L+ Sbjct: 145 EMAPSSIRGRIITRNELMIVTGQFLAFTTNATLGNLFSDLDGVWRWMLALATLPAVALWL 204 Query: 190 GMIRMPESPRWLVSKGRKEDALRVLKKIRDEKRAAAELQEIEFAFKKEDQLEKATFKDLS 249 GM+ MPESPRWL +KGR + L VLK +R+E A AE++ I E ++K ++DLS Sbjct: 205 GMLYMPESPRWLATKGRFREGLEVLKLVREEYYAKAEMEAITQQISNERFIKKGGWRDLS 264 Query: 250 VPWVRRIVFIGLGIAIVQQITGVNSIMYYGTEILRNSGFQTEAALIGNIANGVISVLATF 309 RRI IG+GIA+ Q+TGVNSIMY+GT+IL +G + +ALI N+ NG+IS+ ATF Sbjct: 265 QKGARRIFLIGIGIAVTSQLTGVNSIMYFGTQILTEAGLEQRSALIANVVNGIISIGATF 324 Query: 310 VGIWLLGRVGRRPMLMTGLIGTTTALLLIGIFSLVLEGSPALPYVVLSLTVTFLAFQQGA 369 VGI LL RVGRRPM++ G GTT +LLLIG+ S+ ++ S ++L FLA QG Sbjct: 325 VGIALLDRVGRRPMMLLGFTGTTLSLLLIGLVSVFVDPSVTRAMLILGAMAMFLASMQGL 384 Query: 370 ISPVTWLMLSEIFPLRLRGLGMGVTVFCLWMVNFAVSFTFPILLAAIGLSTTFFIFVGLG 429 I P W++L+EIFP+R+RG MG+ + W+ N + FP L+A IG+ TFF+FVG G Sbjct: 385 IGPAFWVLLAEIFPMRIRGGCMGMAIAAFWLTNVMIGMFFPSLVAMIGIGQTFFVFVGAG 444 Query: 430 ICSVLFVKRFLPETKGLSLEQLEE 453 + S+ FV ++PET+G +LE++E+ Sbjct: 445 LLSLTFVAVWVPETRGSTLEEIEQ 468 Lambda K H 0.327 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 706 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 472 Length adjustment: 33 Effective length of query: 440 Effective length of database: 439 Effective search space: 193160 Effective search space used: 193160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory