Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate Pf6N2E2_1147 Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)
Query= BRENDA::P77467 (262 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1147 Length = 257 Score = 139 bits (351), Expect = 5e-38 Identities = 91/263 (34%), Positives = 144/263 (54%), Gaps = 12/263 (4%) Query: 3 EFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCA 62 E IL ++ V +TLNRP+ LN+ N ++ ++L + L +E D I C++LTG+ + F A Sbjct: 4 ETILLEIKDRVGLITLNRPQALNALNAQIVSELNQALDSLEADPKIGCIVLTGSKKAFAA 63 Query: 63 GQDLNDRNVDPTGPA---PDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLAL 119 G D+ + + T P DL +R N RR KP+I AVNG A G G LAL Sbjct: 64 GADIKEM-AELTYPQIYLDDLFSDSDRVAN---RR-----KPIIAAVNGFALGGGCELAL 114 Query: 120 GGDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWG 179 D ++A +AKF LG++P GGT L R G+A+AM + L G + A +A G Sbjct: 115 MCDFILAGDNAKFGQPEVNLGVLPGMGGTQRLTRAVGKAKAMEMCLTGRFIDAVEAERCG 174 Query: 180 MIWQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAG 239 ++ ++V + L D A + A +A++ ++K+++N A +L + ER A Sbjct: 175 IVARIVPADELLDDALKTAALIASKSVPISMMVKESVNRAFEVSLSEGVRFERRVFHAAF 234 Query: 240 RSADYREGVSAFLAKRSPQFTGK 262 + D +EG++AF+AKR+ +F K Sbjct: 235 ATQDQKEGMAAFVAKRAAEFQDK 257 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 257 Length adjustment: 24 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory