Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate Pf6N2E2_1834 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= uniprot:A0A2Z5MCI7 (262 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1834 Length = 256 Score = 146 bits (369), Expect = 4e-40 Identities = 91/261 (34%), Positives = 141/261 (54%), Gaps = 8/261 (3%) Query: 1 MSAELLTSRPTESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGAD 60 MSA ++ R + + +L L+ RNAL M A A+ +ERD + +VITG D Sbjct: 1 MSAPVVVER---NGAVAILRLNRVEKRNALDLSMRVAIASAMQELERDSGVAVIVITGGD 57 Query: 61 NFFCAGGNLNRLLENRAKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLA 120 + F AG +LN L++ A+ Q +DL W + S KP+IAAV G A GAG LA Sbjct: 58 SVFAAGADLNLLVDKGAQ----QVAELDLGQYWAPVAK-SQKPLIAAVSGFALGAGCELA 112 Query: 121 LACDLIVAADDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHEL 180 + CD++VA + A+F ARVG+ P GG+ L +A+ + +A+ +L+ G+ + A R +L Sbjct: 113 MMCDILVADNSARFGQPEARVGIMPGAGGTQRLLRAVGKPVASLMLLAGELLSAERASQL 172 Query: 181 GVVNKLTKPGTARDAAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVAS 240 G+V++L G+A A+ A + P ++ IK ++ Q L L E F+ Sbjct: 173 GLVSELVTEGSALARAIVLAQATATMPPKALRAIKRVLALGADQSLDLALALENREFLLL 232 Query: 241 LHHREGLEGISAFLEKRAPVY 261 ++ EG+ AFL+KR P Y Sbjct: 233 FDTQDKTEGMRAFLDKRPPRY 253 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 256 Length adjustment: 24 Effective length of query: 238 Effective length of database: 232 Effective search space: 55216 Effective search space used: 55216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory