Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate Pf6N2E2_1835 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::O87873 (258 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1835 Length = 203 Score = 63.5 bits (153), Expect = 3e-15 Identities = 58/184 (31%), Positives = 85/184 (46%), Gaps = 25/184 (13%) Query: 80 QMLKSLHGLVREMLDSPVPILVALRGQCLGGGLEVAAAGNLLFAAPDAKFGQPEIRLGVF 139 + ++ +H L R + P+P++ A+ G C G G+ +A G+++ + +F P ++LG+ Sbjct: 21 ERMQHIHQLCRLLGQFPMPVISAVEGICAGAGVGLALLGDVVLSGTKTRFLFPFLKLGL- 79 Query: 140 APAASCL--LPPRVGQACAEDLLWSGRSIDGAEGHRIGLIDVLAEDPEAAALRWFDEHIA 197 +P L LP RVG A A+ +L G+ I E GL D E L D Sbjct: 80 SPDWGLLRTLPARVGVAEAKRMLTHGQYISAEEAVVAGLAD------ECVGLNVMD---- 129 Query: 198 RLSASSLRFAVRAARCDSVPRIKQKLDTVEALYLEELMASHD--AV--------EGLKAF 247 SA SL + D+ R+K +LD A EEL D AV EG AF Sbjct: 130 --SAVSLASRMSRLPRDAFSRMKNRLDHPSASLAEELQREEDDQAVLLLGADFREGFAAF 187 Query: 248 LEKR 251 EKR Sbjct: 188 AEKR 191 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 101 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 203 Length adjustment: 23 Effective length of query: 235 Effective length of database: 180 Effective search space: 42300 Effective search space used: 42300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory