GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pad-dh in Pseudomonas fluorescens FW300-N2E2

Align phenylacetaldehyde dehydrogenase (EC 1.2.1.39) (characterized)
to candidate Pf6N2E2_1878 Aldehyde dehydrogenase (EC 1.2.1.3)

Query= BRENDA::Q5P171
         (474 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1878 Aldehyde
           dehydrogenase (EC 1.2.1.3)
          Length = 472

 Score =  409 bits (1050), Expect = e-118
 Identities = 215/474 (45%), Positives = 286/474 (60%), Gaps = 5/474 (1%)

Query: 1   MQVFDMIINGKPVRAGSTFDVVNPATGEVFARVQAGDASHVDQAVAAARAAFPGWSRTPD 60
           +Q F + ING+   +  T   +NPAT E          + +++AV AA+ AF  W  TP 
Sbjct: 3   LQTFKLSINGRAEESLETAFAINPATEEPICEYPLASRTQLEEAVQAAKIAFTDWRATPI 62

Query: 61  AERKRLMHALGAALEAHMPELMELVTKEAGKPLGGLNGVGSGMEVGGAIAWTHVTADLEL 120
            +RK+L+ A G  +E      + L+T E GK   G        E+ G I W    A   L
Sbjct: 63  EQRKKLVAAFGDIIEERREAFITLLTTEQGKGRSGAE-----WEIDGCIHWCREIAKQSL 117

Query: 121 PVEVIQDNDDARIEVHRKPLGVVGSITPWNWPLMIAIWHVIPALRAGNTVVIKPSGMTPT 180
             E  Q      I     P+GV+G+ITPWN+PL++AIW V PAL AGNT+V+KPS  TP 
Sbjct: 118 EDEFPQGVTGELIVSRHTPIGVIGAITPWNFPLLLAIWKVAPALLAGNTMVLKPSPFTPL 177

Query: 181 ATIRFVELANAILPPGVLNIVTGESGVGSAIAKHPDINKIVFTGSTPTGKNIMQNAAGNL 240
            T+ F ELAN ILPPGVLN+++G + +G  I +HPDI KI FTGST TGK +MQ+A+ NL
Sbjct: 178 CTLWFGELANKILPPGVLNVLSGGNELGQLITEHPDIGKISFTGSTATGKRVMQSASTNL 237

Query: 241 KRLTLELGGNDAGIVLPDVDPKAIAPKLFGVGFHNNGQTCACLKRLYVHDSIYEKVCAEL 300
           KRLTLELGGND  IV PDVDPKAIA  LF   F N+GQ C   KRLYVH+ IY++V  EL
Sbjct: 238 KRLTLELGGNDPAIVFPDVDPKAIAQDLFWAAFANSGQFCVATKRLYVHEDIYDEVAREL 297

Query: 301 ARIAKETVVGDGLVEGTELGPVQNKAQLDFVQELVEDARAHGARILSGGKARSGGGFFFE 360
              A    +G+G      LGP+QN+ Q + V++L+ D +  G   + GG+     G+F  
Sbjct: 298 VAYAGTVKMGNGADPEVALGPLQNRMQFNKVKDLLLDCKTRGFSFIMGGELEERKGYFIP 357

Query: 361 PTVIADAKDGMRVVDEEQFGPVLPVIRYSDIEEVIARANNNENGLGGSIWSKDHAKAAEL 420
            T+I +     R V EE FGPVLP+I+Y D+E+VI +AN++E GL  +IWSKD   A  +
Sbjct: 358 VTIIDNPPADARCVVEEAFGPVLPMIKYRDLEDVIKQANSSEYGLAATIWSKDLDTAQRV 417

Query: 421 ALRLECGTAWVNEHGAVQPDAPFGGVKQSGLGVEFGRYGLEEYTSIQTLKIMKA 474
           A ++E GT W+N      P   FGG K SG+G+E   +GL EYT+IQT+ +  A
Sbjct: 418 AKQIESGTVWINHAHQFSPHVAFGGQKNSGMGIENSLHGLAEYTNIQTVLLKAA 471


Lambda     K      H
   0.317    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 600
Number of extensions: 22
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 474
Length of database: 472
Length adjustment: 33
Effective length of query: 441
Effective length of database: 439
Effective search space:   193599
Effective search space used:   193599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory