GapMind for catabolism of small carbon sources

 

Aligments for a candidate for AZOBR_RS08240 in Pseudomonas fluorescens FW300-N2E2

Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate Pf6N2E2_2924 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

Query= uniprot:G8ALI9
         (505 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2924 Branched-chain amino
           acid transport system permease protein LivM (TC
           3.A.1.4.1)
          Length = 418

 Score =  414 bits (1063), Expect = e-120
 Identities = 207/324 (63%), Positives = 252/324 (77%), Gaps = 3/324 (0%)

Query: 149 RWLGPIAVVVALAFPFTPLADRQLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYA 208
           RW+    +V AL +PF     R  +DI  L+L Y+MLG GLNIVVGLAGLLDLGYV FYA
Sbjct: 92  RWIVLALIVGALVWPF--FGSRGAVDIATLILIYVMLGLGLNIVVGLAGLLDLGYVGFYA 149

Query: 209 VGAYSYALLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRI 268
           VGAYSYALL+HYFG SFW+CLP+AG +AA  G LLGFPVLRLRGDY AIVTLGFGEIIR+
Sbjct: 150 VGAYSYALLSHYFGLSFWICLPIAGMMAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRL 209

Query: 269 ILINWYQFTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYL 328
            L N    TGGPNGIS I +P+FFG+  F R  AEG   FHE FGLE++ ++++IFLY +
Sbjct: 210 FLRNLTDITGGPNGISNIEKPTFFGLT-FERKAAEGLQTFHEYFGLEYNSINKVIFLYLV 268

Query: 329 ILVLALVVNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFAG 388
            L+LAL       R+ ++P+GRAWEALRED+IAC +LG+N T +KL+AF + A F GFAG
Sbjct: 269 ALLLALAALFVINRLLRMPIGRAWEALREDEIACRALGLNPTVIKLSAFTLGAAFAGFAG 328

Query: 389 SFFATRQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRM 448
           SFFA RQG ++PESFTFIESAIILAIVVLGGMGSQ+GV++AA ++I LPE  RE ++YRM
Sbjct: 329 SFFAARQGLVTPESFTFIESAIILAIVVLGGMGSQLGVILAAIVMILLPEMMREFSEYRM 388

Query: 449 LAFGMGMVLIMLWRPRGLLAHRDP 472
           L FG  MVL+M+WRP+GLL  + P
Sbjct: 389 LMFGALMVLMMIWRPQGLLPMQRP 412


Lambda     K      H
   0.329    0.144    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 623
Number of extensions: 35
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 505
Length of database: 418
Length adjustment: 33
Effective length of query: 472
Effective length of database: 385
Effective search space:   181720
Effective search space used:   181720
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory