Align proline porter II (characterized)
to candidate Pf6N2E2_388 Transporter, MFS superfamily
Query= CharProtDB::CH_024324 (500 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_388 Length = 447 Score = 242 bits (618), Expect = 2e-68 Identities = 138/430 (32%), Positives = 234/430 (54%), Gaps = 12/430 (2%) Query: 18 IDDGKLR--KAITAASL-GNAMEWFDFGVYGFVAYAL-GKVFFPGADPSVQMVAALATFS 73 +DD K + K + A SL G A+E +D +YG A + +FFPG D +V +A+LA+F+ Sbjct: 16 VDDEKKKSMKNVVAGSLFGTALETYDLYLYGTAAALIFAPLFFPGTDEAVSRLASLASFA 75 Query: 74 VPFLIRPLGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYDTIGIWAPILLLIC 133 + F+ RPLG L G GD+ GR+K+L +T++IM +ST IGL+P+Y ++GIWAPI+L + Sbjct: 76 ISFVARPLGSLVLGHFGDRIGRKKLLYLTLIIMGLSTVGIGLLPTYASVGIWAPIMLCVL 135 Query: 134 KMAQGFSVGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVLISTIVGEA 193 + QGF+ GEY+GA + + E++P RKRGF + + G + GF+ AG+++++S+++ Sbjct: 136 RFIQGFAFAGEYSGAVLMLLEHAPRRKRGFYAAINNIGPVFGFIASAGLLLIVSSLLSVE 195 Query: 194 NFLDWGWRIPFFIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDREGLQDGPKVS-FKE 252 +F WGWRIPF +L L ++G+++R + E+P F++ +K + GP +S Sbjct: 196 DFYKWGWRIPFIASLALLVVGVFVRSKVAESPVFEKTAEK------RAVAKGPDLSPAMR 249 Query: 253 IATKYWRSLLTCIGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLIIIAIMIGMLFVQ 312 + TKY + LL G I T+Y+ + SY L S + + + + L + Sbjct: 250 LFTKYPKQLLLVAGANICHFSTFYLFTVFALSYGQKELGLSNAFVLAVAMVAICTHLVIV 309 Query: 313 PVMGLLSDRFGRRPFVLLGSVALFVLAIPAFILINSNVIGLIFAGLLMLAVILNCFTGVM 372 P G ++DR GRR +L+G + A P + L ++ + G + G + Sbjct: 310 PFAGAMADRLGRRTMMLIGFAVTALAAFPFWHLFSTGQFLPMVLGSCLFMAGYGLVYGAV 369 Query: 373 ASTLPAMFPTHIRYSALAAAFNISVLVAGLT-PTLAAWLVESSQNLMMPAYYLMVVAVVG 431 S F R++ A A N+ ++ G T P + A+L+ + + Y +V+A + Sbjct: 370 PSFTGEAFGPSARFTGFAMATNVGGIIGGGTAPIVGAYLLSHYGSPYAISVYTVVLAAIS 429 Query: 432 LITGVTMKET 441 + ET Sbjct: 430 ALCVYLSAET 439 Score = 25.4 bits (54), Expect = 0.004 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 5/95 (5%) Query: 32 LGNAMEWFDFG-VYGFVAYALGKVFFPGADPSVQMVAALATFSVPFLIRPLGGLFFGMLG 90 LG+ + +G VYG V G+ F P A + +A + P+ G + L Sbjct: 353 LGSCLFMAGYGLVYGAVPSFTGEAFGPSARFTGFAMATNVGGIIGGGTAPIVGAY---LL 409 Query: 91 DKYGRQKILAI-TIVIMSISTFCIGLIPSYDTIGI 124 YG +++ T+V+ +IS C+ L TI I Sbjct: 410 SHYGSPYAISVYTVVLAAISALCVYLSAETRTINI 444 Lambda K H 0.327 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 601 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 500 Length of database: 447 Length adjustment: 33 Effective length of query: 467 Effective length of database: 414 Effective search space: 193338 Effective search space used: 193338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory