Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate Pf6N2E2_3463 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)
Query= BRENDA::Q9I6J2 (456 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3463 Length = 456 Score = 268 bits (686), Expect = 2e-76 Identities = 163/445 (36%), Positives = 243/445 (54%), Gaps = 23/445 (5%) Query: 16 LSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELV 75 L D H P+T + ++ R+I AEG ++ D +G K+ D+++GLW G+ R+E+ Sbjct: 22 LKLDAHWMPYTANRHF-QRDPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQ 80 Query: 76 QAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVR 135 +A +Q+ L Y+ FQ HP +LA+ I + P +NHVFFT SGSE DT ++MVR Sbjct: 81 EAVAKQLGTLD-YSPGFQYGHPLSFQLAEKITSLTPGNLNHVFFTDSGSECADTAVKMVR 139 Query: 136 HYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGM---KALHEQGDFPIPGIVH-IAQPYW 191 YW KGQ K +IGR GYHG +AG SLGG+ + L Q + + H + Sbjct: 140 AYWRLKGQATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQAMMDVDHLPHTLLASNA 199 Query: 192 YGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREI 251 Y G P E G+ A++L K I N+AA EP+ G+ GV+VPP+ Y ++REI Sbjct: 200 YSRG---MPKEGGIALADELLKLIELHDASNIAAVFVEPMAGSAGVLVPPEGYLKRLREI 256 Query: 252 LAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVE 311 ++ IL + DEVI GFGRTG FG+ +G PDLM IAK +T+G IPMG V+ EI + Sbjct: 257 CDQHSILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASSEIYQ 316 Query: 312 V-LNQ-----GGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQE 365 +NQ EF HG+TYS HPVA A L + +L++E +++ V AE AP+ + Sbjct: 317 TFMNQPTPEYAVEFPHGYTYSAHPVACAAGLAALDLLQKENLVQSV-AEIAPHFENALHG 375 Query: 366 LADHPLVGEARGVGMVAALELV-KNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMI 424 L V + R G+ A+++ ++ R + G+ + ++ G +R GDT+ Sbjct: 376 LKGAKNVIDIRNYGLAGAIQIAGRDGDAIVRPFEAGMAL------WKAGFYVRFGGDTLQ 429 Query: 425 ISPPLVIDPSQIDELITLARKCLDQ 449 P P +D L + L++ Sbjct: 430 FGPTFNSKPQDLDRLFDAVGEVLNK 454 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 456 Length adjustment: 33 Effective length of query: 423 Effective length of database: 423 Effective search space: 178929 Effective search space used: 178929 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory