Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate Pf6N2E2_5209 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5209 Length = 257 Score = 152 bits (384), Expect = 7e-42 Identities = 101/258 (39%), Positives = 143/258 (55%), Gaps = 18/258 (6%) Query: 5 DKVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAV--AEVVAEIEALGR 62 +K+ IVTGG GIG+ + GA V I G R AV A+V EI+A G+ Sbjct: 6 NKIAIVTGGGSGIGKEVTKRLVEAGASVVI----------GGRDAVKLAQVAQEIDASGQ 55 Query: 63 RVIAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVNL 122 +V G++A T Q LV +FG VD+L +NAGI FL++ PE ++ + + L Sbjct: 56 KVRFHAGDIAKPATAQALVDLAASSFGGVDILINNAGIFNPKPFLEVSPEEYDAFLDIIL 115 Query: 123 NGAFYVTQAAAQQMKLQGTGGAIVATSSISAL--VGGGMQTHYTPTKAGVHSLMQSCAVA 180 G F++ QAAA+ M +G GGAIV T S+ A+ +G Y+ AGVH+L ++ A+ Sbjct: 116 KGKFFMAQAAAKAMLKRG-GGAIVQTGSLWAIQAIGATPSAAYSAANAGVHALTRNLALE 174 Query: 181 LGPYGIRCNSVMPGTIATDLNAQDL-ADEAKKAY--FEKRIPLGRLGRPEDVADCVTFLA 237 L IR N+V P + T + + AD+ K+ F PLGR G+P DVA + FLA Sbjct: 175 LAGSNIRINTVAPAVVETPVYGTFMDADQVKEVLPTFNAFHPLGRNGQPADVAQAMLFLA 234 Query: 238 SDRARYVTGAALLVDGGL 255 SD A ++TG L VDGG+ Sbjct: 235 SDEASWITGTVLPVDGGV 252 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory