Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate Pf6N2E2_5952 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= SwissProt::Q9HK58 (254 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5952 Length = 247 Score = 125 bits (314), Expect = 8e-34 Identities = 83/251 (33%), Positives = 136/251 (54%), Gaps = 4/251 (1%) Query: 2 LDFKGKNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHKV 61 + +GK A++TG SRGIG+AIAL L +QGA I+I A+ S A+ + T + G++ + Sbjct: 1 MSLQGKVALVTGASRGIGQAIALELGRQGA-IVIGTATSASGAERIAATLKENGIQGTGL 59 Query: 62 KVDQSDPYESIRFAEKAIETFGKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVESHYF 121 +++ + E FG ILV+NAGI R+ D + V N+ S Y Sbjct: 60 ELNVTSDESVAAVLASIQEQFGAPAILVNNAGITRDNLMMRMKDDEWFDVVDTNLNSLYR 119 Query: 122 ITQRIAKNMIENKINGRILLISSISAHVGGEFQTHYTTTKSALNGFMHSIAIVLGKYGIL 181 +++ + + M + + GRI+ I S+ +G Q +Y K+ L GF ++A +G I Sbjct: 120 LSKGVLRGMTKARW-GRIISIGSVVGAMGNAGQVNYAAAKAGLEGFSRALAREVGSRSIT 178 Query: 182 VNSLEPGTILTDINKEDLSNQEKRAYMERRTVVGRLGLPEDMVAPALFLLSDDNTYVTGT 241 VNS+ PG I TD+ +E L ++ A + + +GRLG +++ + FL SD YVTG Sbjct: 179 VNSVAPGFIDTDMTRE-LPEAQREALL-TQIPLGRLGQAQEIASVVAFLASDGAAYVTGA 236 Query: 242 ELLADGGMLIN 252 + +GGM ++ Sbjct: 237 TIPVNGGMYMS 247 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 247 Length adjustment: 24 Effective length of query: 230 Effective length of database: 223 Effective search space: 51290 Effective search space used: 51290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory