GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaT' in Pseudomonas fluorescens FW300-N2E2

Align RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate Pf6N2E2_1008 Inositol transport system ATP-binding protein

Query= TCDB::Q7BSH4
         (512 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1008 Inositol transport
           system ATP-binding protein
          Length = 485

 Score =  317 bits (813), Expect = 5e-91
 Identities = 186/476 (39%), Positives = 291/476 (61%), Gaps = 18/476 (3%)

Query: 51  LIGENGAGKSTLVKILTGIYRPNEGEILVDGRPTTFASAQAAI---DAGVTAIHQETVLF 107
           L+GENGAGKST++KIL G    + G+  ++            I   + G+  I+QE  L 
Sbjct: 1   LLGENGAGKSTILKILAGAQPADAGQGSLEFNGHVLGEHDTPIRRQEVGIITIYQEFNLI 60

Query: 108 DELTVAENIFLGHAPRTRFRTIDWQTMNSRSKALLTALESNIDPTIRLKDLSIAQRHLVA 167
            +++VAEN++LG  P  R   +DW+ M S ++ +L  L  +I P   ++ LS+A++ +V 
Sbjct: 61  ADMSVAENMYLGREP-LRHGFVDWKQMFSDAQHVLDDLGLHITPRTMVRKLSVAEQQMVE 119

Query: 168 IARALSIEARIVIMDEPTAALSRKEIDDLFRIVRGLKEQGKAILFISHKFDELYEIADDF 227
           IA+AL++ A+++IMDEPTAALS +E+D L  I+  LK +G +I+++SHK +E+    D +
Sbjct: 120 IAKALTMNAKLIIMDEPTAALSGREVDKLHEIITDLKAKGISIIYVSHKLNEVKACCDRY 179

Query: 228 VVFPRRSRRPVRGVSRKTPQDEIVRMMVGRDVENVFPKIDVAIGGPVLEIRNYS------ 281
            +F R       G       D+IVR+MVGRDVE V   +  A G  +L++++ S      
Sbjct: 180 TIF-RDGAYITSGDVCDVSVDDIVRLMVGRDVEFVRKPLTGAPGEVMLKVQSVSRTAAGG 238

Query: 282 ----HRTEFRDISFTLRKGEILGVYGLIGAGRSELSQSLFGITKPLSGKMVLEGQEIT-I 336
               H T   D+S  +R GEI+G  GL+GAGR+EL++ +FG      G + + G++++  
Sbjct: 239 GRSLHATPLLDMSVDVRAGEIVGFAGLVGAGRTELARVIFGADGCDEGMIYVNGRQVSPF 298

Query: 337 HSPQDAIRAGIVYVPEERGRHGLALPMPIFQNMTLPSLARTSRRG-FLRAANEFALARKY 395
            SP++ I AG+  VPE+R +    L   I  NM+LPSL    R G F+    E  L + Y
Sbjct: 299 KSPREGIAAGVALVPEDRKQQACFLSHSIRWNMSLPSLGGLQRWGMFIDDRAETQLIQDY 358

Query: 396 AERLDLRAAALSVPVGTLSGGNQQKVVIGKWLATAPKVIILDEPTKGIDIGSKAAVHGFI 455
            +RL ++ +  SV +GTLSGGNQQKV++ + +A  PKV+I+DEPT+GID+G+KA VH  +
Sbjct: 359 QKRLRIKMSNDSVAIGTLSGGNQQKVILARCMALKPKVLIVDEPTRGIDVGAKAEVHQLL 418

Query: 456 SELAAEGLSIIMVSSELPEIIGMSDRVLVMKEGLSAGIFERAELSPEALV-RAATG 510
            ++A  G+++I++SSELPE++ +SDR++  +EG   GI    E + E L+ R A G
Sbjct: 419 FDMARAGVAVIVISSELPEVMAVSDRIVTFREGQITGIVSADEATEELLMARMAQG 474



 Score = 59.7 bits (143), Expect = 2e-13
 Identities = 53/249 (21%), Positives = 111/249 (44%), Gaps = 29/249 (11%)

Query: 38  NVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNEGEILVDGRPTT-FASAQAAIDAG 96
           ++S+ +  G +    G  GAG++ L +++ G    +EG I V+GR  + F S +  I AG
Sbjct: 249 DMSVDVRAGEIVGFAGLVGAGRTELARVIFGADGCDEGMIYVNGRQVSPFKSPREGIAAG 308

Query: 97  VTAIHQETVLFDELTVAENIFLGHAPRTRFR----------------TIDWQTMNSRSKA 140
           V  + ++          +  FL H+ R                      + Q +    K 
Sbjct: 309 VALVPED-------RKQQACFLSHSIRWNMSLPSLGGLQRWGMFIDDRAETQLIQDYQKR 361

Query: 141 LLTALESNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPTAALSRKEIDDLFRIV 200
           L   + ++   ++ +  LS   +  V +AR ++++ +++I+DEPT  +      ++ +++
Sbjct: 362 LRIKMSND---SVAIGTLSGGNQQKVILARCMALKPKVLIVDEPTRGIDVGAKAEVHQLL 418

Query: 201 RGLKEQGKAILFISHKFDELYEIADDFVVFPRRSRRPVRGVSRKTPQDEIVRMMVGRDVE 260
             +   G A++ IS +  E+  ++D  V F  R  +    VS     +E++   + + V 
Sbjct: 419 FDMARAGVAVIVISSELPEVMAVSDRIVTF--REGQITGIVSADEATEELLMARMAQGVS 476

Query: 261 NVFPKIDVA 269
           + F +  VA
Sbjct: 477 SSFSQQGVA 485


Lambda     K      H
   0.320    0.137    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 590
Number of extensions: 37
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 512
Length of database: 485
Length adjustment: 34
Effective length of query: 478
Effective length of database: 451
Effective search space:   215578
Effective search space used:   215578
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory