GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaT' in Pseudomonas fluorescens FW300-N2E2

Align RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate Pf6N2E2_1456 D-xylose transport ATP-binding protein XylG

Query= TCDB::Q7BSH4
         (512 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1456 D-xylose transport
           ATP-binding protein XylG
          Length = 518

 Score =  351 bits (900), Expect = e-101
 Identities = 204/500 (40%), Positives = 306/500 (61%), Gaps = 12/500 (2%)

Query: 20  ILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPN--EGEI 77
           +L+M GI + F GVKAL+ + I + PG    L GENGAGKSTL+K+L+ +Y     +GEI
Sbjct: 5   LLQMNGIVKTFGGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPYGTWDGEI 64

Query: 78  LVDGRPTTFASAQAAIDAGVTAIHQETVLFDELTVAENIFLGHAPRTRFRTIDWQTMNSR 137
           L DG+P    S      AG+  IHQE  L  +L+VAENIF+GH        +++  M  R
Sbjct: 65  LWDGQPLKAQSISETEAAGIVIIHQELTLVPDLSVAENIFMGHELTLPGGRMNYPAMIHR 124

Query: 138 SKALLTALE-SNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPTAALSRKEIDDL 196
           ++AL+  L+  +++ ++ +       + LV IA+AL+ +AR++I+DEP++AL+R EI+ L
Sbjct: 125 AEALMRELKVPDMNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALTRSEIEVL 184

Query: 197 FRIVRGLKEQGKAILFISHKFDELYEIADDFVVFPRRSRRPVRGVSRKTPQDEIVRMMVG 256
             I+R LK +G A ++ISHK DE+  + D   V  R  +             +I+  MVG
Sbjct: 185 LDIIRDLKAKGVACVYISHKLDEVAAVCDTISVI-RDGKHIATTAMADMSIPKIITQMVG 243

Query: 257 RDVENVFPKIDVAIGGPVLEIRNYS-------HRTEFRDISFTLRKGEILGVYGLIGAGR 309
           R++ N++P     +G  + E R+++        R    DISF L++GEILG+ GL+GAGR
Sbjct: 244 REMSNLYPTEPHDVGEVIFEARHFTCYDVDNPRRKRVDDISFVLKRGEILGIAGLVGAGR 303

Query: 310 SELSQSLFGITKP-LSGKMVLEGQEITIHSPQDAIRAGIVYVPEERGRHGLALPMPIFQN 368
           +EL  +LFG       G++ L GQ+I   +P  +IRAG+  VPE+R R G+   + + QN
Sbjct: 304 TELVSALFGAYPGRYEGEVWLNGQQIDTRTPLKSIRAGLCMVPEDRKRQGIIPDLGVGQN 363

Query: 369 MTLPSLARTSRRGFLRAANEFALARKYAERLDLRAAALSVPVGTLSGGNQQKVVIGKWLA 428
           +TL  L   S+   + A  E     K   R+ L+ A+  +P+ +LSGGNQQK V+ K L 
Sbjct: 364 ITLAVLDNYSKLTRIDAEAELGSIDKEISRMHLKTASPFLPITSLSGGNQQKAVLAKMLL 423

Query: 429 TAPKVIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMKEG 488
           T P+V+ILDEPT+G+D+G+K  ++  +  LAAEG+SIIMVSSEL E++G+SDRVLV+ +G
Sbjct: 424 TKPRVLILDEPTRGVDVGAKYEIYKLMGALAAEGVSIIMVSSELAEVLGVSDRVLVIGDG 483

Query: 489 LSAGIFERAELSPEALVRAA 508
              G F   EL+ E ++ AA
Sbjct: 484 QLRGDFINHELTQEQVLAAA 503



 Score = 72.4 bits (176), Expect = 4e-17
 Identities = 62/227 (27%), Positives = 108/227 (47%), Gaps = 12/227 (5%)

Query: 289 ISFTLRKGEILGVYGLIGAGRSELSQSLFGITK--PLSGKMVLEGQEITIHSPQDAIRAG 346
           I   +R GE +G+ G  GAG+S L + L  +       G+++ +GQ +   S  +   AG
Sbjct: 24  IDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPYGTWDGEILWDGQPLKAQSISETEAAG 83

Query: 347 IVYVPEERGR-HGLALPMPIFQN--MTLPSLARTSRRGFLRAANEFALARKYAERLDLRA 403
           IV + +E      L++   IF    +TLP   R +    +  A   AL R+    L +  
Sbjct: 84  IVIIHQELTLVPDLSVAENIFMGHELTLPG-GRMNYPAMIHRAE--ALMRE----LKVPD 136

Query: 404 AALSVPVGTLSGGNQQKVVIGKWLATAPKVIILDEPTKGIDIGSKAAVHGFISELAAEGL 463
             +S+PV    GG QQ V I K L    +++ILDEP+  +       +   I +L A+G+
Sbjct: 137 MNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALTRSEIEVLLDIIRDLKAKGV 196

Query: 464 SIIMVSSELPEIIGMSDRVLVMKEGLSAGIFERAELSPEALVRAATG 510
           + + +S +L E+  + D + V+++G        A++S   ++    G
Sbjct: 197 ACVYISHKLDEVAAVCDTISVIRDGKHIATTAMADMSIPKIITQMVG 243


Lambda     K      H
   0.320    0.137    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 605
Number of extensions: 29
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 512
Length of database: 518
Length adjustment: 35
Effective length of query: 477
Effective length of database: 483
Effective search space:   230391
Effective search space used:   230391
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory