GapMind for catabolism of small carbon sources

 

Aligments for a candidate for tpi in Pseudomonas fluorescens FW300-N2E2

Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate Pf6N2E2_3356 Triosephosphate isomerase (EC 5.3.1.1)

Query= BRENDA::P0A858
         (255 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3356 Triosephosphate
           isomerase (EC 5.3.1.1)
          Length = 247

 Score =  229 bits (584), Expect = 4e-65
 Identities = 122/246 (49%), Positives = 161/246 (65%), Gaps = 2/246 (0%)

Query: 5   LVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQ 64
           +V GNWK++G+R  V EL+  LR  LA  +G  VA+ PP +YI+      +G  I +GAQ
Sbjct: 1   MVAGNWKMHGTRASVAELIKGLR-HLALPSGVDVAVFPPCLYINQVVDGLKGKSISVGAQ 59

Query: 65  NVDL-NLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTP 123
           N  + ++ GA TGE + + L D G   ++IGHSERR    E D+ + +KF+  +  GL P
Sbjct: 60  NSAVESMQGALTGEIAPSQLVDAGCSLVLIGHSERRQIMGEQDKALIRKFSAAQACGLIP 119

Query: 124 VLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQA 183
           VLC+GET  + EAGKT EV  RQ+  +++  G  AF  AVIAYEPVWAIGTG +A+P QA
Sbjct: 120 VLCVGETREQREAGKTLEVVGRQLGGIIEELGVDAFAKAVIAYEPVWAIGTGLTASPQQA 179

Query: 184 QAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFA 243
           Q VH  IR  +A  ++ +A  V + YGGSV A+NAAELF  PDIDG L+GGASL AD F 
Sbjct: 180 QDVHAAIRAQLAAENSEVARGVRLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFG 239

Query: 244 VIVKAA 249
            I +AA
Sbjct: 240 AICRAA 245


Lambda     K      H
   0.316    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 176
Number of extensions: 7
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 255
Length of database: 247
Length adjustment: 24
Effective length of query: 231
Effective length of database: 223
Effective search space:    51513
Effective search space used:    51513
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 46 (22.3 bits)

Align candidate Pf6N2E2_3356 (Triosephosphate isomerase (EC 5.3.1.1))
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00419.hmm
# target sequence database:        /tmp/gapView.5484.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00419  [M=228]
Accession:   TIGR00419
Description: tim: triose-phosphate isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
    7.5e-67  211.5   0.8    8.6e-67  211.3   0.8    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3356  Triosephosphate isomerase (EC 5.


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3356  Triosephosphate isomerase (EC 5.3.1.1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.3   0.8   8.6e-67   8.6e-67       1     228 []       1     236 [.       1     236 [. 0.94

  Alignments for each domain:
  == domain 1  score: 211.3 bits;  conditional E-value: 8.6e-67
                                      TIGR00419   1 lviinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvda 63 
                                                    +v +n+K+++++ +v++++  l+ ++a ++gv vav pp ++++ v+d ++   i+v+Aqn  +
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3356   1 MVAGNWKMHGTRASVAELIKGLR-HLALPSGVDVAVFPPCLYINQVVDGLKgKSISVGAQNSAV 63 
                                                    699******************98.69*************************999*******988 PP

                                      TIGR00419  64 vk.sGaftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetl 126
                                                     + +Ga tGei    l+d+G+  vligHsErR ++ e d+ +  k++ +++ gl +v+Cvget 
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3356  64 ESmQGALTGEIAPSQLVDAGCSLVLIGHSERRQIMGEQDKALIRKFSAAQACGLIPVLCVGETR 127
                                                    6538************************************************************ PP

                                      TIGR00419 127 eereaartinnvattaaaaA.......lepdvvAvEPveliGtGkpvskAeaevveksvrdhlk 183
                                                    e+rea++t+++v ++ + +        + ++v+A+EPv++iGtG ++s+ +a+ v++ +r  l+
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3356 128 EQREAGKTLEVVGRQLGGIIeelgvdaFAKAVIAYEPVWAIGTGLTASPQQAQDVHAAIRAQLA 191
                                                    ****88888877766655544444444************************************* PP

                                      TIGR00419 184 kvskevaesvrvlyGasvtaaedaelaaqldvdGvLlasavlkae 228
                                                      + eva+ vr+lyG+sv+aa++ael+  +d+dG L+++a+l a+
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3356 192 AENSEVARGVRLLYGGSVKAANAAELFGMPDIDGGLIGGASLNAD 236
                                                    ******************************************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (228 nodes)
Target sequences:                          1  (247 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 5.86
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory