Align Ribose import permease protein RbsC (characterized)
to candidate Pf6N2E2_524 Inositol transport system permease protein
Query= SwissProt::P0AGI1 (321 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_524 Length = 340 Score = 211 bits (538), Expect = 2e-59 Identities = 122/281 (43%), Positives = 173/281 (61%), Gaps = 21/281 (7%) Query: 49 ILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGI------------EVN 96 ++ Q S+ ++A+G+T VI+T+GIDLS GS+LAL+ +AAS+ ++ Sbjct: 59 MILQVSIIGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLP 118 Query: 97 ALVAVAAALALGAAIGAVTGVIVAKGRVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFTE 156 + V A L +G GA+ G I+A + FIATL MM+ RG+ YT G PV+ Sbjct: 119 VWIPVVAGLGVGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSM---- 174 Query: 157 NADLFGWFGIGRPLGVPTPVWIMGIVFLAAWYMLHHTRLGRYIYALGGNEAATRLSGINV 216 +D + G G PV I +V + L +T+ G+Y YA+GGN A R SGINV Sbjct: 175 LSDSYTAIGHGA-----MPVIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINV 229 Query: 217 NKIKIIVYSLCGLLASLAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIV 276 + +IVYS+ GLLA LAG++ AR ++ Q G YELDAIAA V+GGTSLAGG GRI Sbjct: 230 KRHLVIVYSIAGLLAGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRIT 289 Query: 277 GTLIGALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVD 317 GT+IGALILG + +G +GV +Y Q I+K ++I++AV++D Sbjct: 290 GTVIGALILGVMASGFTFVGVDAYIQDIIKGLIIVVAVVID 330 Lambda K H 0.324 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 340 Length adjustment: 28 Effective length of query: 293 Effective length of database: 312 Effective search space: 91416 Effective search space used: 91416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory