Align Ribose import permease protein RbsC (characterized)
to candidate Pf6N2E2_5970 L-arabinose transport system permease protein (TC 3.A.1.2.2)
Query= SwissProt::P0AGI1 (321 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5970 Length = 322 Score = 212 bits (540), Expect = 9e-60 Identities = 112/312 (35%), Positives = 185/312 (59%), Gaps = 8/312 (2%) Query: 10 RYFTKAWLMEQKSLIALLVLIAIVSTLSPNFFTINNLFNILQQTSVNAIMAVGMTLVILT 69 R F W+M L+A + + + + + NF + N+ + S I A M + + Sbjct: 18 RRFLDDWVM----LLAAIGIFVLCTLMIDNFLSPLNMRGLGLAISTTGIAACTMLYCLAS 73 Query: 70 SGIDLSVGSLLALTGAVAASIVGIEVNALVAVAAALALGAAIGAVTGVIVAKGRVQAFIA 129 DLSVGS++A G VAA ++ + + ++AAL +G +G + G+++AK RV A I Sbjct: 74 GHFDLSVGSVIACAGVVAAVVMRDTNSVFLGISAALVMGLIVGLINGIVIAKLRVNALIT 133 Query: 130 TLVMMLLLRGVTMVYTNGSPVNTGFTENADLFGWFGIGRPLGVPTPVWIMGIVFLAAWYM 189 TL M ++RG+ ++ NG V + + F FG G+ GVP P+ I + FL ++ Sbjct: 134 TLATMQIVRGLAYIFANGKAVGV----SQESFFVFGNGQMFGVPVPILITIVCFLFFGWL 189 Query: 190 LHHTRLGRYIYALGGNEAATRLSGINVNKIKIIVYSLCGLLASLAGIIEVARLSSAQPTA 249 L++T GR A+GGN+ A L+G+NV++ KII++++ G++ +LAG+I +R++S QP Sbjct: 190 LNYTTYGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGVIGALAGVILASRMTSGQPMI 249 Query: 250 GTGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSYYQMIVKAVV 309 G G+EL I+A VLGG SL+GG G I + G LIL + N +NL + ++YQ +++ + Sbjct: 250 GQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSI 309 Query: 310 ILLAVLVDNKKQ 321 +LLAV++D KQ Sbjct: 310 LLLAVVIDRLKQ 321 Lambda K H 0.324 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 322 Length adjustment: 28 Effective length of query: 293 Effective length of database: 294 Effective search space: 86142 Effective search space used: 86142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory