GapMind for catabolism of small carbon sources


Aligments for a candidate for rbsK in Pseudomonas fluorescens FW300-N2E2

Align Ribokinase (EC (characterized)
to candidate Pf6N2E2_165 Ribokinase (EC

Query= reanno::pseudo5_N2C3_1:AO356_00950
         (304 letters)

>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_165 Ribokinase (EC
          Length = 304

 Score =  554 bits (1427), Expect = e-162
 Identities = 287/304 (94%), Positives = 294/304 (96%)






Query: 301 AFKS 304
Sbjct: 301 AFKS 304

Lambda     K      H
   0.318    0.133    0.377 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 484
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 304
Length of database: 304
Length adjustment: 27
Effective length of query: 277
Effective length of database: 277
Effective search space:    76729
Effective search space used:    76729
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate Pf6N2E2_165 (Ribokinase (EC
to HMM TIGR02152 (rbsK: ribokinase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02152.hmm
# target sequence database:        /tmp/gapView.20417.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02152  [M=298]
Accession:   TIGR02152
Description: D_ribokin_bact: ribokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
     3e-116  373.9   6.1   3.3e-116  373.7   6.1    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_165  Ribokinase (EC

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_165  Ribokinase (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  373.7   6.1  3.3e-116  3.3e-116       1     297 [.       5     300 ..       5     301 .. 0.99

  Alignments for each domain:
  == domain 1  score: 373.7 bits;  conditional E-value: 3.3e-116
                                     TIGR02152   1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDefge 65 
                                                   +vv+GS+n+Dlv+r++rlp+ Get+ +e+f++++GGKGANQAvaaarlgaevsm+g+vG+D++ge
                                                   79*************************************************************** PP

                                     TIGR02152  66 ellenlkkegidteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaeekikesd 130
                                                   +l+  l +egid++ v+ v+  ++GvAli+vd++++N+Iv+vaGan  lt+e++++  e ++++d
                                                   *****************9966.56***************************************** PP

                                     TIGR02152 131 lvllQlEipletveealkiakkagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgieve 195
                                                   ++++QlE+p +tv +alk a++ g+ v+lnPAPa+++l++++++ +d++vpNe+Ea++L+g +v+
                                                   ***************************************************************** PP

                                     TIGR02152 196 dledaekaaekllekgvkaviitlGskGallvskdekklipalkvkavDttaAGDtFigalavaL 260
                                                   +le+ae+aa++l + g+ +vi+tlG++G ++++  + +++pa +vkavDttaAGDtF+g++a+aL
                                                   ***************************************************************** PP

                                     TIGR02152 261 aegksledavrfanaaaalsVtrkGaqssiPtkeeve 297
                                                   a+gks  da+rf++aaaalsVtr+Gaq+siPt+ ev+
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_165 264 ASGKSEVDAIRFGQAAAALSVTRAGAQPSIPTLLEVQ 300
                                                   ***********************************97 PP

Internal pipeline statistics summary:
Query model(s):                            1  (298 nodes)
Target sequences:                          1  (304 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 7.17

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory