GapMind for catabolism of small carbon sources

 

Aligments for a candidate for edd in Pseudomonas fluorescens FW300-N2E2

Align phosphogluconate dehydratase (EC 4.2.1.12) (characterized)
to candidate Pf6N2E2_2898 Phosphogluconate dehydratase (EC 4.2.1.12)

Query= BRENDA::Q1PAG1
         (608 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 Phosphogluconate
           dehydratase (EC 4.2.1.12)
          Length = 608

 Score = 1134 bits (2933), Expect = 0.0
 Identities = 571/607 (94%), Positives = 591/607 (97%)

Query: 1   MHPRVLEVTERLVARSRATREAYLALIRGAASDGPQRGKLQCANFAHGVAGCGSEDKHSL 60
           MHPRVLEVTERL+ARSRATR+AYLALIRGAASDGP RGKLQCANFAHGVAGCG+EDKH L
Sbjct: 1   MHPRVLEVTERLIARSRATRQAYLALIRGAASDGPTRGKLQCANFAHGVAGCGTEDKHHL 60

Query: 61  RMMNAANVAIVSSYNDMLSAHQPYEHFPEQIKKALREMGSVGQFAGGTPAMCDGVTQGEA 120
           RMMNAAN+AIVSSYNDMLSAHQPYE FPEQIKKALRE+GSVGQFAGGTPAMCDGVTQGEA
Sbjct: 61  RMMNAANIAIVSSYNDMLSAHQPYETFPEQIKKALREIGSVGQFAGGTPAMCDGVTQGEA 120

Query: 121 GMELSLPSREVIALSTAVALSHNMFDAALMLGICDKIVPGLMMGALRFGHLPTIFVPGGP 180
           GMELSLPSREVIALSTAVALSHNMFD ALMLGICDKIVPGLMMGALRFGHLPTIFVPGGP
Sbjct: 121 GMELSLPSREVIALSTAVALSHNMFDGALMLGICDKIVPGLMMGALRFGHLPTIFVPGGP 180

Query: 181 MPSGISNKEKADVRQRYAEGKATREELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGLH 240
           M SGISNKEKADVRQRYAEGKATREELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGLH
Sbjct: 181 MVSGISNKEKADVRQRYAEGKATREELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGLH 240

Query: 241 LPGASFVNPYTPLRDALTHEAAQQVTRLTKQSGNFTPIGEIVDERSLVNSIVALHATGGS 300
           LPGASFVNP TPLRDALT EAA QVTR+TKQSGNF PIGEIVDERSLVNSIVALHATGGS
Sbjct: 241 LPGASFVNPNTPLRDALTREAAFQVTRMTKQSGNFMPIGEIVDERSLVNSIVALHATGGS 300

Query: 301 TNHTLHMPAIAQAAGIQLTWQDMADLSEVVPTLSHVYPNGKADINHFQAAGGMAFLIREL 360
           TNHTLHMPAIA AAGIQLTWQDMADLSEVVPTLSHVYPNGKADINHFQAAGGM+FLIREL
Sbjct: 301 TNHTLHMPAIAMAAGIQLTWQDMADLSEVVPTLSHVYPNGKADINHFQAAGGMSFLIREL 360

Query: 361 LEAGLLHEDVNTVAGRGLSRYTQEPFLDNGKLVWRDGPIESLDENILRPVARAFSPEGGL 420
           LEAGLLHE+VNTV G GLSRYTQEPFL++G+LVWRDGPIESLDENILRPVARAFSPEGGL
Sbjct: 361 LEAGLLHENVNTVLGHGLSRYTQEPFLEDGELVWRDGPIESLDENILRPVARAFSPEGGL 420

Query: 421 RVMEGNLGRGVMKVSAVALQHQIVEAPAVVFQDQQDLADAFKAGELEKDFVAVMRFQGPR 480
           RVMEGNLGRGVMKVSAVAL++Q+VEAPA+VFQDQQDLADAFKAG LEKDFVAVMRFQGPR
Sbjct: 421 RVMEGNLGRGVMKVSAVALENQVVEAPAMVFQDQQDLADAFKAGLLEKDFVAVMRFQGPR 480

Query: 481 SNGMPELHKMTPFLGVLQDRGFKVALVTDGRMSGASGKIPAAIHVSPEAQVGGALARVRD 540
           SNGMPELHKMTPFLGVLQDRGFKVALVTDGRMSGASGKIPAAIHVSPEA VGGALARV++
Sbjct: 481 SNGMPELHKMTPFLGVLQDRGFKVALVTDGRMSGASGKIPAAIHVSPEAYVGGALARVQE 540

Query: 541 GDIIRVDGVKGTLELKVDADEFAAREPAKGLLGNNVGSGRELFGFMRMAFSSAEQGASAF 600
           GDIIRVDGVKGTLELKVDA+EFAAR PAKGLLGNN+G+GRELFGFMRMAFSSAEQGASAF
Sbjct: 541 GDIIRVDGVKGTLELKVDAEEFAARTPAKGLLGNNIGTGRELFGFMRMAFSSAEQGASAF 600

Query: 601 TSALENL 607
           TSALE L
Sbjct: 601 TSALETL 607


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1374
Number of extensions: 50
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 608
Length of database: 608
Length adjustment: 37
Effective length of query: 571
Effective length of database: 571
Effective search space:   326041
Effective search space used:   326041
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

Align candidate Pf6N2E2_2898 (Phosphogluconate dehydratase (EC 4.2.1.12))
to HMM TIGR01196 (edd: phosphogluconate dehydratase (EC 4.2.1.12))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01196.hmm
# target sequence database:        /tmp/gapView.3869.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01196  [M=601]
Accession:   TIGR01196
Description: edd: phosphogluconate dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
          0 1028.8   0.6          0 1028.6   0.6    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898  Phosphogluconate dehydratase (EC


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898  Phosphogluconate dehydratase (EC 4.2.1.12)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1028.6   0.6         0         0       1     601 []       2     601 ..       2     601 .. 0.99

  Alignments for each domain:
  == domain 1  score: 1028.6 bits;  conditional E-value: 0
                                      TIGR01196   1 hsrlaeiteriierskktrekylekirsaktkgklrstlgcgnlahgvaalsesekvelksekr 64 
                                                    h+r++e+ter+i+rs++tr++yl+ ir a++ g+ r++l c+n+ahgva +  ++k +l+ ++ 
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898   2 HPRVLEVTERLIARSRATRQAYLALIRGAASDGPTRGKLQCANFAHGVAGCGTEDKHHLRMMNA 65 
                                                    79************************************************************** PP

                                      TIGR01196  65 knlaiitayndmlsahqpfkeypdlikkalqeanavaqvagGvpamcdGvtqGedGmelsllsr 128
                                                    +n+ai+++yndmlsahqp++++p++ikkal+e ++v+q agG+pamcdGvtqGe+Gmelsl sr
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898  66 ANIAIVSSYNDMLSAHQPYETFPEQIKKALREIGSVGQFAGGTPAMCDGVTQGEAGMELSLPSR 129
                                                    **************************************************************** PP

                                      TIGR01196 129 dvialstaiglshnmfdgalflGvcdkivpGlliaalsfGhlpavfvpaGpmasGlenkekakv 192
                                                    +vialsta++lshnmfdgal+lG+cdkivpGl+++al fGhlp++fvp+Gpm+sG++nkeka v
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 130 EVIALSTAVALSHNMFDGALMLGICDKIVPGLMMGALRFGHLPTIFVPGGPMVSGISNKEKADV 193
                                                    **************************************************************** PP

                                      TIGR01196 193 rqlfaeGkvdreellksemasyhapGtctfyGtansnqmlvelmGlhlpgasfvnpntplrdal 256
                                                    rq +aeGk++reell+sem+syh+pGtctfyGtan+nq+l+e+mGlhlpgasfvnpntplrdal
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 194 RQRYAEGKATREELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGLHLPGASFVNPNTPLRDAL 257
                                                    **************************************************************** PP

                                      TIGR01196 257 treaakrlarltakngevlplaelideksivnalvgllatGGstnhtlhlvaiaraaGiilnwd 320
                                                    treaa +++r+t ++g+++p++e++de+s+vn++v+l+atGGstnhtlh+ aia aaGi+l+w+
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 258 TREAAFQVTRMTKQSGNFMPIGEIVDERSLVNSIVALHATGGSTNHTLHMPAIAMAAGIQLTWQ 321
                                                    **************************************************************** PP

                                      TIGR01196 321 dlselsdlvpllarvypnGkadvnhfeaaGGlsflirellkeGllhedvetvagkGlrrytkep 384
                                                    d+ +ls++vp+l +vypnGkad+nhf+aaGG+sflirell++Gllhe+v+tv+g+Gl+ryt+ep
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 322 DMADLSEVVPTLSHVYPNGKADINHFQAAGGMSFLIRELLEAGLLHENVNTVLGHGLSRYTQEP 385
                                                    **************************************************************** PP

                                      TIGR01196 385 fledgkleyreaaeksldedilrkvdkpfsaeGGlkllkGnlGravikvsavkeesrvieapai 448
                                                    fledg+l++r+++ +slde+ilr+v + fs+eGGl++++GnlGr+v+kvsav+ e++v+eapa+
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 386 FLEDGELVWRDGPIESLDENILRPVARAFSPEGGLRVMEGNLGRGVMKVSAVALENQVVEAPAM 449
                                                    **************************************************************** PP

                                      TIGR01196 449 vfkdqaellaafkagelerdlvavvrfqGpkanGmpelhklttvlGvlqdrgfkvalvtdGrls 512
                                                    vf+dq++l++afkag le+d+vav+rfqGp++nGmpelhk+t++lGvlqdrgfkvalvtdGr+s
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 450 VFQDQQDLADAFKAGLLEKDFVAVMRFQGPRSNGMPELHKMTPFLGVLQDRGFKVALVTDGRMS 513
                                                    **************************************************************** PP

                                      TIGR01196 513 GasGkvpaaihvtpealegGalakirdGdlirldavngelevlvddaelkareleeldlednel 576
                                                    GasGk+paaihv+pea+ gGala++++Gd+ir+d+v+g le+ vd  e++ar++++  l  n++
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 514 GASGKIPAAIHVSPEAYVGGALARVQEGDIIRVDGVKGTLELKVDAEEFAARTPAK-GLLGNNI 576
                                                    *****************************************************776.566789* PP

                                      TIGR01196 577 GlGrelfaalrekvssaeeGasslt 601
                                                    G+Grelf ++r + ssae+Gas++t
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2898 577 GTGRELFGFMRMAFSSAEQGASAFT 601
                                                    *********************9986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (601 nodes)
Target sequences:                          1  (608 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.03
# Mc/sec: 9.50
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory